Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.05
PubTator Score 24.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -1.681 1.1e-02
cystic fibrosis 1.400 4.3e-03
Endometriosis -1.150 1.5e-02

Gene RIF (5)

PMID Text
22028439 In thyroid carcinomas, as determined by quantitative RT-PCR, CDH16 expression decreases in papillary, follicular, and anaplastic thyroid carcinomas, and the decrease is more pronounced than that of CDH1.
18343407 The interaction of Ksp-cadherin with alpha B-crystallin is important for the connection of Ksp-cadherin to the cytoskeleton and thus for maintaining tissue integrity in the kidney.
17895753 Ksp-cad is a useful tumor type associated marker for distinguishing chromophobe renal cell carcinoma and renal oncocytoma from the wide range of nonintercalated cell-related adult renal epithelial neoplasms.
15886705 Ksp-cadherin expression downregulated inrenal cell carcinoma; this cell adhesion molecule may have role in tumour suppression
15670782 These results indicated that LIF induced multi-lineage differentiation of adult stem-like cells in kidney via cadherin 16.

AA Sequence

MVPAWLWLLCVSVPQALPKAQPAELSVEVPENYGGNFPLYLTKLPLPREGAEGQIVLSGDSGKATEGPFA      1 - 70
MDPDSGFLLVTRALDREEQAEYQLQVTLEMQDGHVLWGPQPVLVHVKDENDQVPHFSQAIYRARLSRGTR     71 - 140
PGIPFLFLEASDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLDHALERTYQLL    141 - 210
VQVKDMGDQASGHQATATVEVSIIESTWVSLEPIHLAENLKVLYPHHMAQVHWSGGDVHYHLESHPPGPF    211 - 280
EVNAEGNLYVTRELDREAQAEYLLQVRAQNSHGEDYAAPLELHVLVMDENDNVPICPPRDPTVSIPELSP    281 - 350
PGTEVTRLSAEDADAPGSPNSHVVYQLLSPEPEDGVEGRAFQVDPTSGSVTLGVLPLRAGQNILLLVLAM    351 - 420
DLAGAEGGFSSTCEVEVAVTDINDHAPEFITSQIGPISLPEDVEPGTLVAMLTAIDADLEPAFRLMDFAI    421 - 490
ERGDTEGTFGLDWEPDSGHVRLRLCKNLSYEAAPSHEVVVVVQSVAKLVGPGPGPGATATVTVLVERVMP    491 - 560
PPKLDQESYEASVPISAPAGSFLLTIQPSDPISRTLRFSLVNDSEGWLCIEKFSGEVHTAQSLQGAQPGD    561 - 630
TYTVLVEAQDTDEPRLSASAPLVIHFLKAPPAPALTLAPVPSQYLCTPRQDHGLIVSGPSKDPDLASGHG    631 - 700
PYSFTLGPNPTVQRDWRLQTLNGSHAYLTLALHWVEPREHIIPVVVSHNAQMWQLLVRVIVCRCNVEGQC    701 - 770
MRKVGRMKGMPTKLSAVGILVGTLVAIGIFLILIFTHWTMSRKKDPDQPADSVPLKATV               771 - 829
//

Text Mined References (18)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22028439 2012 CDH16/Ksp-cadherin is expressed in the developing thyroid gland and is strongly down-regulated in thyroid carcinomas.
18343407 2008 alpha B-crystallin is a cytoplasmic interaction partner of the kidney-specific cadherin-16.
17895753 2007 Expression analysis of kidney-specific cadherin in a wide spectrum of traditional and newly recognized renal epithelial neoplasms: diagnostic and histogenetic implications.
15886705 2005 Expression of Ksp-cadherin during kidney development and in renal cell carcinoma.
15670782 2005 Leukemia inhibitory factor induces multi-lineage differentiation of adult stem-like cells in kidney via kidney-specific cadherin 16.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15023525 2004 Ksp-cadherin is a functional cell-cell adhesion molecule related to LI-cadherin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12851251 2003 Histopathological analysis of renal cystic epithelia in the Pkd2WS25/- mouse model of ADPKD.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10828602 2000 Assignment of E-cadherin (CDH1) and KSP-cadherin (CDH16) to chromosome 16q22.1 by radiation hybrid mapping.
10409308 1999 Immunolocalization of Ksp-cadherin in the adult and developing rabbit kidney.
9721215 1998 cDNA cloning and chromosomal localization of the human and mouse isoforms of Ksp-cadherin.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7615566 1995 Isolation and cDNA cloning of Ksp-cadherin, a novel kidney-specific member of the cadherin multigene family.