Property Summary

NCBI Gene PubMed Count 21
PubMed Score 33.23
PubTator Score 40.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.379 1.7e-02
atypical teratoid / rhabdoid tumor -1.400 3.0e-04
glioblastoma -1.500 1.1e-03
diabetes mellitus -1.200 1.1e-02
adult high grade glioma -1.600 2.7e-03
lung adenocarcinoma 1.300 2.6e-04

Gene RIF (4)

PMID Text
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19012874 Alterations in CDH15 in patients with mild to severe intellectual disability are reported.
12052883 The cell adhesion molecule M-cadherin is not essential for muscle development and regeneration.

AA Sequence

MDAAFLLVLGLLAQSLCLSLGVPGWRRPTTLYPWRRAPALSRVRRAWVIPPISVSENHKRLPYPLVQIKS      1 - 70
DKQQLGSVIYSIQGPGVDEEPRGVFSIDKFTGKVFLNAMLDREKTDRFRLRAFALDLGGSTLEDPTDLEI     71 - 140
VVVDQNDNRPAFLQEAFTGRVLEGAVPGTYVTRAEATDADDPETDNAALRFSILQQGSPELFSIDELTGE    141 - 210
IRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGR    211 - 280
LEVEDRDLPGSPNWVARFTILEGDPDGQFTIRTDPKTNEGVLSIVKALDYESCEHYELKVSVQNEAPLQA    281 - 350
AALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPED    351 - 420
WLQVDAATGRIQTQHVLSPASPFLKGGWYRAIVLAQDDASQPRTATGTLSIEILEVNDHAPVLAPPPPGS    421 - 490
LCSEPHQGPGLLLGATDEDLPPHGAPFHFQLSPRLPELGRNWSLSQVNVSHARLRPRHQVPEGLHRLSLL    491 - 560
LRDSGQPPQQREQPLNVTVCRCGKDGVCLPGAAALLAGGTGLSLGALVIVLASALLLLVLVLLVALRARF    561 - 630
WKQSRGKGLLHGPQDDLRDNVLNYDEQGGGEEDQDAYDISQLRHPTALSLPLGPPPLRRDAPQGRLHPQP    631 - 700
PRVLPTSPLDIADFINDGLEAADSDPSVPPYDTALIYDYEGDGSVAGTLSSILSSQGDEDQDYDYLRDWG    701 - 770
PRFARLADMYGHPCGLEYGARWDHQAREGLSPGALLPRHRGRTA                              771 - 814
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19012874 2008 Alterations in CDH15 and KIRREL3 in patients with mild to severe intellectual disability.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12634428 2003 Promyogenic members of the Ig and cadherin families associate to positively regulate differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12052883 2002 The cell adhesion molecule M-cadherin is not essential for muscle development and regeneration.
11136230 2001 Interaction of Galpha 12 and Galpha 13 with the cytoplasmic domain of cadherin provides a mechanism for beta -catenin release.
11058098 2000 The armadillo repeat region targets ARVCF to cadherin-based cellular junctions.
10861224 2000 Identification of three human type-II classic cadherins and frequent heterophilic interactions between different subclasses of type-II classic cadherins.
9615235 1998 Localization of human cadherin genes to chromosome regions exhibiting cancer-related loss of heterozygosity.
9545347 1998 Molecular cloning and characterization of a novel human classic cadherin homologous with mouse muscle cadherin.
9168809 1997 M-cadherin-mediated cell adhesion and complex formation with the catenins in myogenic mouse cells.
9030594 1997 Identification of human cadherin-14, a novel neurally specific type II cadherin, by protein interaction cloning.
8059975 1994 Immunocytochemistry of M-cadherin in mature and regenerating rat muscle.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.
1840697 1991 Expression of M-cadherin, a member of the cadherin multigene family, correlates with differentiation of skeletal muscle cells.
1427864 1992 The gene for the cell adhesion molecule M-cadherin maps to mouse chromosome 8 and human chromosome 16q24.1-qter and is near the E-cadherin (uvomorulin) locus in both species.