Property Summary

NCBI Gene PubMed Count 171
PubMed Score 189.29
PubTator Score 208.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
non-small cell lung carcinoma -1.400 4.7e-15
breast carcinoma -1.500 1.1e-04
fibroadenoma -1.400 4.5e-02
lung adenocarcinoma -1.800 2.8e-18

Gene RIF (123)

PMID Text
26600672 CDH13 locus variants and adiponectin levels are associated with circulating levels of cellular adhesion molecules and adiposity status in a differential manner that interacts with sex
26597461 Data demonstrate for the first time that SHP1 methylation has high specificity for diagnosis of endometrial carcinoma, while CDH13 promoter methylation plays a role in the earlier stage.
26362652 The present study identified a new genetic factor for CRC risk and an interaction between CDH13 and APN in CRC risk. These genetic factors may be useful for predicting CRC risk.
25875811 The genetic polymorphisms at the CDH13 locus independently affect the adiponectin levels, whereas the adiponectin levels exhibit a suppressive effect on the association between CDH13 locus variants and various metabolic phenotypes and metabolic syndrome
25847144 The downregulation of T-cadherin may contribute to gastric cancer progression, representing a useful biomarker for predicting the biological behavior and prognosis of gastric cancer.
25739828 The CDH13 rs11150556 CC genotype was associated with more hyperactive/impulsive symptoms in attention/deficit hyperactivity disorder.
25735345 CDH13 promoter methylation is associated with lung cancer.
25677746 Our results suggested that negative T-cadherin expression has a worse prognosis in patients with axillary lymph node-positive breast cancer.
25543204 Several SNPs in the CDH13 promoter region are significantly associated with the level of DNA methylation at nearby CpG sites.
25450229 This study finding significant excess of rare nonsynonymous variants exclusive to European Americans smokers in CHD13.
25381040 T-cadherin regulates prostate cancer cell behavior by tuning the balance in EGFR/IGF-1R activity and enhancing the impact of IGF-1R
25349169 Finnish prisoners, revealed that a monoamine oxidase A (MAOA) low-activity genotype (contributing to low dopamine turnover rate) as well as the CDH13 gene (coding for neuronal membrane adhesion protein) are associated with extremely violent behavior
25196672 CDH13 methylation is a frequent event in non-muscle invasive bladder cancer.
25015764 Aberrant promoter methylation of the cadherin 13 gene in serum is associated with prostate cancer.
24998565 High methylation level of CDH13 gene promoter region is associated with low drug sensitivity of non-small cell lung cancer.
24968695 High frequency of CDH13 hypermethylation is associated with melanoma brain metastases.
24888493 down-regulation of adiponectin receptors (AdipoR1, R2, and T-cadherin) in osteoarthritic chondrocytes
24815187 T-cadherin exhibited a state of insulin insensitivity as evidenced by attenuation of the ability of insulin to stimulate Akt/mTOR axis signaling, phosphorylation of MLC20 and MYPT1
24688318 The SNPs in ADP-ribosylation factor-like protein 15 (ARL15) and the T-cadherin (CDH13) genes did not exhibit significant association with individual metabolic traits in the T2DM and NDM groups.
24675084 Adiponectin/T-cadherin and apelin/APJ expression patterns were found to be inversely associated with human aortic and coronary atherosclerosis.
24559850 A non significant trend for higher levels of total adiponectin was observed in adult attention deficit hyperactivity disorder patients carrying CDH13 missense mutations compared to patients with wild type CDH13.
24142632 The results provide evidence that CDH13 variants are associated with metabolic traits and carotid atherosclerosis in Koreans.
24136461 T-cadherin up-regulation is involved in degradation of VE-cadherin, resulting in the disruption of endothelial barrier function.
24041676 CDH13 genotype may be a factor that affects not only the plasma level of HMWA but also the prognostic significance of HMWA.
24010971 Cadherin 13 might play a role in the protoporphyrin (Pp)IX accumulation pathway and act as a negative regulator of 5-ALA-induced fluorescence in glioma cells.
24009259 CDH13 variants strongly influence plasma total and high molecular weight adiponectin levels in East Asian populations but appear to alter adiponectin sensitivity, resulting in better metabolic health than expected based on circulating adiponectin levels.
23936508 the frequency of coding CDH13 variants in adult attention deficit/hyperactivity disorder
23625515 High CDH-13 expression is associated with melanoma.
23463326 high expressionsin uterine leiomyoma, associated with color Doppler flow imaging
23411345 T-cadherin translocation to cell-cell contacts is sensitive to the activity status of EGFR, requires lipid raft domain integrity and actin filament polymerization, and crucial intracellular signalling mediators include Rac1 and p38MAPK.
23369463 Data indicate that T-cadherin-silencing promotes experimental metastasis of squamous cell carcinoma (SCC).
23358160 The SNPs most strongly associated in the single-marker analysis of the combined Danish samples were rs4757144 in ARNTL (P=3.78 x 10-6) and rs8057927 in CDH13.
23235385 Downregulated expression of CDH13 is associated with increased invasion of bladder transitional cell carcinoma
23149075 genome-wide association study in populations in Minnesota and Utah: Data suggest that SNPs on chromosome 12 and in CDH13 (H-cadherin) are associated with baseline circulating levels of adiponectin (and response of adiponectin levels to fenofibrate).
23069940 The present study investigated transcriptional regulation of CDH13 in melanoma. Found an inverse correlation between BRN2 and T-cadherin protein and transcript expression in melanoma.
22952603 CDH13 may have a role in d-amphetamine response in healthy volunteers based on a genome-wide association study
22942707 CDH13 DNA is methylated in only ten percent of cervical cancer patients.
22695491 Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancers was associated with clinical characteristics, but only RASSF1A methylation was associated with time to first recurrence and overall survival.
22592160 It was shown that the main consequence of T-cad silencing in squamous cell carcinoma is facilitation of ligand-dependent EGFR activation. T-cadherin modulates the EGFR pathway activity by influencing membrane compartmentalization of EGFR.
22414547 HER-2/neu and TOPIIa are over expressed in gastric tumors and may promote disease progression.
22321935 Aberrant methylation in promoter region is an important mechanism of T-cadherin gene inactivation in esophageal carcinoma cells. 5-Aza-CdR can increase expression of T-cadherin by a reversal of hypermethylation and inhibit cell proliferation and invasion.
22235028 T-cad expression modulates signalling and functional responses of the vascular endothelium to insulin.
22105624 This study identifying loci for aADHD and led to the identification of CHD13 as novel genes associated with ADHD across the lifespan.
22065538 Identification of a strong statistically associated SNP (rs4783244) with adiponectin levels in the first intron of CDH13 (T-cadherin) gene in a 30-kb haplotype block covering the promoter region to first intron.
21872196 The CDH13 rs11646213 T > A polymorphism was consistently associated with metabolic syndrome in Swedish women
21815997 The mechanisms underlying the associations between CDH13 and the clinical phenotype of attention deficit/hyperactivity disorder and verbal working memory are still unknown
21796503 CDH13 gene methylation is associated with colorectal cancer.
21771975 These findings indicated the role of T-cadherin in modulating adiponectin levels and the involvement of CDH13 or adiponectin in the development of cardiometabolic diseases.
21710692 Promoter hypermethylation of PAX6, BRCA2, PAX5, WT1, CDH13 and MSH6 seems to be a frequent early event in breast cancer
21672320 CDH13 methylation was significantly associated with advanced tumour stage, high-grade tumour, large tumour size, tumour recurrence and poor prognosis.
21617638 effect of smoking and obesity on the association between CDH13 (rs3865188) and adiponectin among Korean men.
21331343 myocyte expression of peroxisome proliferator-activated receptor delta and the adiponectin receptors 1 and 2 and T-cadherin are highly coordinated and this might be of relevance for human lipid metabolism in vivo
21298366 Loss of T-cadherin due to 5' CpG island methylation is associated with colon carcinoma.
21252481 Decreased T-cad expression in tumor tissues is closely associated with malignancy in bladder transitional cell carcinoma
21071540 Observational study of gene-disease association. (HuGE Navigator)
20887962 Genetic variants in CDH13 influence adiponectin levels in Korean adults.
20887962 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20876611 These findings provide the first genome-wide significant evidence of association with plasma adiponectin at the CDH13 locus and identify a novel uncommon KNG1-ADIPOQ haplotype strongly associated with adiponectin levels in Filipinos.
20876611 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20732627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20446882 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20161066 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20121546 These finding suggest that T-cadherin might inhibit tumor progression through multiple pathways, including the Akt and SET7/9-p53 pathways.
20090771 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20039365 Findings provide the first demonstration that the interplay between Rap1 and E-cadherin along the endocytic recycling pathway serves as a timely and efficient mechanism to regulate hESC self-renewal.
20039275 Data implicate T-cadherin in regulation of endothelial barrier function, and suggest a complex signaling network that links T-cadherin and regulation of barrier function.
20030915 The methylation of JunB and CDH13 gene promoters probably plays a role in the pathogenesis of chronic myelogenous leukemia and may have clinical significance in predicting prognosis of CML.
19955471 Observational study of gene-disease association. (HuGE Navigator)
19799609 a decrease in CDH1, CDH13, and TIMP3 expression levels with an increase in CD44 can be used as an indicator for invasion in both ER-positive and -negative breast tumors.
19726744 deregulation of T-cadherin in endothelial cells may lead to disturbances in cytokinesis or centrosomal replication.
19638398 EC1 and EC5 domains of T-cad are essential for its proangiogenic effects. DeltaI and DeltaV constructs may serve as dominant-negative mutants and as potential tools targeting excessive angiogenesis.
19581569 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19463088 T-cadherin transcriptionally activated Rac1 and Cdc42.
19368692 Results show that H-cadherin expression is lost in nearly 80% of the analyzed melanoma cell lines.
19336575 Observational study of gene-disease association. (HuGE Navigator)
19304780 CDH13 as a novel susceptibility locus contributes to high blood pressure in European populations.
19304780 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19199263 The study showed that the reduction of the CDH13 expression at different clinical stage of CML may account for the defective cell adhesion in CML, and the expression of the CDH13 gene was probably down-regulated by the BCR/ABL fusion gene.
19165155 ADIPOQ and CDH13 single-nucleotide polymorphisms are associated with variation in adiponectin levels.
19165155 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19116147 These findings suggest that Zeb1 represses T-cadherin expression and thus increases the invasive activity of gallbladder cancer.
18957941 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18839057 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18821565 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18729198 hypermethylation of CDH13 is a common, tissue-specific event in esophageal adenocarcinoma, occurs early during Barrett esophagus-associated neoplastic progression, and correlates with known clinical neoplastic progression risk factors
18656243 In the tubular breast carcinoma samples, the highest frequencies for DNA sequence copy number losses were detected for CDH13 (in 86% of the samples)
18627351 thioredoxin-1 is an important determinant of redox-sensitive transcriptional up-regulation of T-cad in vascular endothelial cells.
18553387 The underexpression of T-cadherin in HCC cells suggests it may be another critical event in addition to T-cadherin-mediated angiogenesis during HCC development.
18550521 T-cadherin may be involved in reversible and dynamic cellular adhesion-deadhesion processes, which are consistent with its role in cell growth and migration
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18519763 methylation status of CDH13 may help predict clinical outcome in patients with endometrial cancer.
18425332 T-cadherin down-regulation by promoter methylation is associated with the development and progression of hepatocellular carcinoma. Suggest that T-cadherin is an important tumor suppressor in liver cancer.
18411300 Grp78/BiP has a role in T-cadherin-dependent cell survival
18349282 Methylation of CDH13 was present in 80% of NSCLC tissues but only in 14% of noncancerous tissues.
18337602 Methylation of the promoter region of CDH13 in patients with stage I NSCLC treated with curative intent by means of surgery is associated with early recurrence.
18264096 Susceptibility genes CPNE3, IL16 and CDH13 with moderate effects associated with susceptibility to prostate cancer.
18264096 Genome-wide association study of gene-disease association. (HuGE Navigator)
17967182 Results identified CDH13 loci showing significant differential DNA methylation levels between tumor and non-tumor lung and highly significant hypermethylation in adenocarcinoma.
17960794 The current findings suggested that simultaneous methylation of the E-cadherin and H-cadherin genes occurs in a subset of NSCLCs
17873891 tumor-specific downregulation of expression and methylation of CDH13 and CDH1, alone or in combination, may be involved in the development and invasive growth of pituitary adenomas.
17765896 Results show that T-cadherin upregulation on endothelial cells may potentiate intratumoral angiogenesis.
17573778 T-cadherin may modulate cell-matrix adhesion in basal keratinocytes as well as invasive potency in squamous cell carcinoma by regulating surface level of beta1 integrin
17094449 Methylation of H-cadherin is associated with advanced esophageal squamous cell carcinoma
17077306 T-cadherin expression in tumor cells might occur by cadherin-switching during epithelial-mesenchymal transition and may represent an additional mechanism contributing to hepatoma metastasis.
16273386 T-cadherin was selectively expressed in intratumoral capillary endothelial cells of hepatocellular carcinomas and increasingly expressed with tumor progression.
16222700 The frequency of p16INK4A or CDH13 hypermethylation in patient serum and the total lack of methylation in serum from healthy individuals, offer a promising tool for non invasive early detection of lung cancer.
16133358 Data suggest a functional role of T-/H-cadherin for the differentiation of the podocytes and the formation of the glomerular capillary network.
16099944 T-cad overexpression in vascular endothelial cells protects against stress-induced apoptosis through activation of the PI3K/Akt/mTOR survival signal pathway and concomitant suppression of the p38 MAPK proapoptotic pathway
15821437 T-cad mediates low-density lipoprotein-initiated cell proliferation via the Ca(2+)-tyrosine kinase-Erk1/2 pathway.
15816843 T-cadherin acts as an endogenous negative regulator of keratinocyte proliferation and its inactivation is the cause for keratinocyte hyperproliferation in squamous cell carcinoma or in psoriasis vulgaris.
15292927 Digestive tract neoplasms may show abnormal DNA methylation of this protein.
15251938 Hypermethylation of CDH13 is statistically significantly associated with poor disease outcome in cervical cancer.
14997203 CDH13 promoter methylation is associated with poorly differentiated colorectal cancer
14750164 Aberrant methylation of CDH13 is associated with recurrent cervical cancer
14729458 Coating of culture plates with recombinant T-cad protein or with antibody against the first amino-terminal domain of T-cad (anti-EC1) significantly decreased adhesion and spreading of smooth muscle cells and HUVEC.
14579115 T-cadherin is not required for maintenance of intercellular adhesion, but may rather function as a signalling molecule involved in cell-cell recognition and sensing of the environment in processes where cell detachment occurs.
12697869 Our data indicate that the silencing of CDH13 expression by aberrant promoter methylation occurs at an early stage in CML pathogenesis and probably influences the clinical behavior of the disease.
12489108 downregulation is caused by a combination of allelic loss and hypermethylation of the T-cadherin promoter region and is related to cancer invasion
12177241 combination of deletion and aberrant methylation of the T-cadherin gene may play a role in loss of gene expression in a considerable number of invasive cutaneous squamous cell carcinomas
12067979 There is aberrant methylation of the CDH13 (H-cadherin) promoter region in colorectal cancers and adenomas.
11642747 cadherin cell adhesion molecule anchored to the cell surface membrane through a glycosyl phosphatidyl inositol moiety

AA Sequence

MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKGNDKLRYEVSS      1 - 70
PYFKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGSLQDIFKFARTSPVPRQKRSI     71 - 140
VVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGVDQEPKGIFRINENTGSVSVTRTLDREVIAV    141 - 210
YQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNA    211 - 280
LLRYNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATAT    281 - 350
IMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTN    351 - 420
EGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDL    421 - 490
SVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVDNSVYTALFLAIDS    491 - 560
GNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDK    561 - 630
VWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLP    631 - 700
SVLLLSLFSLACL                                                             701 - 713
//

Text Mined References (175)

PMID Year Title
26600672 2015 Differential Associations between CDH13 Genotypes, Adiponectin Levels, and Circulating Levels of Cellular Adhesive Molecules.
26597461 2016 Methylation of tumor suppressor gene CDH13 and SHP1 promoters and their epigenetic regulation by the UHRF1/PRMT5 complex in endometrial carcinoma.
26362652 2015 Gene-gene interaction analysis identifies a new genetic risk factor for colorectal cancer.
25875811 2015 Association of CDH13 genotypes/haplotypes with circulating adiponectin levels, metabolic syndrome, and related metabolic phenotypes: the role of the suppression effect.
25847144 2015 Association between the expression of T-cadherin and vascular endothelial growth factor and the prognosis of patients with gastric cancer.
25739828 2015 Cadherin-13 gene is associated with hyperactive/impulsive symptoms in attention/deficit hyperactivity disorder.
25735345 2015 Quantitative assessment of the diagnostic role of CDH13 promoter methylation in lung cancer.
25729143 2015 Genome-wide association study identifies three novel genetic markers associated with elite endurance performance.
25677746 2015 T-cadherin association with clinicopathological features and prognosis in axillary lymph node-positive breast cancer.
25543204 2015 CDH13 promoter SNPs with pleiotropic effect on cardiometabolic parameters represent methylation QTLs.
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
25381040 2015 EGFR and IGF-1R in regulation of prostate cancer cell phenotype and polarity: opposing functions and modulation by T-cadherin.
25349169 2015 Genetic background of extreme violent behavior.
25196672 2014 Aberrant methylation of CDH13 is a potential biomarker for predicting the recurrence and progression of non muscle invasive bladder cancer.
25015764 2014 Aberrant promoter methylation of the cadherin 13 gene in serum and its relationship with clinicopathological features of prostate cancer.
24998565 2014 Methylation of RASSF1A and CDH13 genes in individualized chemotherapy for patients with non-small cell lung cancer.
24968695 2014 DNA methylation and gene deletion analysis of brain metastases in melanoma patients identifies mutually exclusive molecular alterations.
24888493 2014 Down-regulation of adiponectin receptors in osteoarthritic chondrocytes.
24815187 2014 Regulation of contractile signaling and matrix remodeling by T-cadherin in vascular smooth muscle cells: constitutive and insulin-dependent effects.
24688318 2014 Association study of ARL15 and CDH13 with T2DM in a Han Chinese population.
24675084 Adiponectin/T-cadherin and apelin/APJ expression in human arteries and periadventitial fat: implication of local adipokine signaling in atherosclerosis?
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24559850 2014 Decreased serum levels of adiponectin in adult attention deficit hyperactivity disorder.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
24142632 2013 Association between CDH13 variants and cardiometabolic and vascular phenotypes in a Korean population.
24136461 2014 Novel mechanism regulating endothelial permeability via T-cadherin-dependent VE-cadherin phosphorylation and clathrin-mediated endocytosis.
24105470 2014 A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2.
24041676 2014 CDH13 genotype-dependent association of high-molecular weight adiponectin with all-cause mortality: the J-SHIPP study.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
24010971 2013 Cadherin 13 overexpression as an important factor related to the absence of tumor fluorescence in 5-aminolevulinic acid-guided resection of glioma.
24009259 2013 Genetic variation in CDH13 is associated with lower plasma adiponectin levels but greater adiponectin sensitivity in East Asian populations.
23967269 2013 A genome-wide association study of total serum and mite-specific IgEs in asthma patients.
23936508 2013 Functional properties of rare missense variants of human CDH13 found in adult attention deficit/hyperactivity disorder (ADHD) patients.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23717212 2013 Imputation-based meta-analysis of severe malaria in three African populations.
23625515 2014 Loss of T-cadherin (CDH-13) regulates AKT signaling and desensitizes cells to apoptosis in melanoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
23463326 2013 T-cadherin expression in uterine leiomyoma.
23411345 2013 Cross-talk between EGFR and T-cadherin: EGFR activation promotes T-cadherin localization to intercellular contacts.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23369463 2013 T-cadherin loss promotes experimental metastasis of squamous cell carcinoma.
23358160 2014 Genome-wide study of association and interaction with maternal cytomegalovirus infection suggests new schizophrenia loci.
23235385 2013 Downregulation of CDH13 expression promotes invasiveness of bladder transitional cell carcinoma.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
23069940 2012 BRN2 is a transcriptional repressor of CDH13 (T-cadherin) in melanoma cells.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22942707 2012 Clinical relevance of CDH1 and CDH13 DNA-methylation in serum of cervical cancer patients.
22695491 2012 Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancer is associated with clinical characteristics, but only RASSF1A methylation is associated with outcome.
22592160 2012 T-Cadherin is an auxiliary negative regulator of EGFR pathway activity in cutaneous squamous cell carcinoma: impact on cell motility.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
22414547 2012 Decreased expression of T-cadherin is associated with gastric cancer prognosis.
22321935 2011 [Aberrant methylation of T-cadherin gene in human esophageal carcinoma cells].
22235028 2012 T-cadherin attenuates insulin-dependent signalling, eNOS activation, and angiogenesis in vascular endothelial cells.
22105624 2012 The genetics of attention deficit/hyperactivity disorder in adults, a review.
22065538 2012 CDH13 gene coding T-cadherin influences variations in plasma adiponectin levels in the Japanese population.
21872196 2011 A variant upstream of the CDH13 adiponectin receptor gene and metabolic syndrome in Swedes.
21815997 2011 CDH13 is associated with working memory performance in attention deficit/hyperactivity disorder.
21796503 2012 CDH13 and FLBN3 gene methylation are associated with poor prognosis in colorectal cancer.
21771975 2011 A genome-wide association study reveals a quantitative trait locus of adiponectin on CDH13 that predicts cardiometabolic outcomes.
21710692 2011 Frequent promoter hypermethylation of BRCA2, CDH13, MSH6, PAX5, PAX6 and WT1 in ductal carcinoma in situ and invasive breast cancer.
21672320 2011 Clinical significance of CDH13 promoter methylation in serum samples from patients with bladder transitional cell carcinoma.
21617638 2012 Effects of smoking and obesity on the association between CDH13 (rs3865188) and adiponectin among Korean men: the KARE study.
21502573 2011 Genetic predictors of fibrin D-dimer levels in healthy adults.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21331343 2011 The myocyte expression of adiponectin receptors and PPAR? is highly coordinated and reflects lipid metabolism of the human donors.
21298366 2012 Correlation between T-cadherin gene expression and aberrant methylation of T-cadherin promoter in human colon carcinoma cells.
21252481 2011 Clinical significance of T-cadherin tissue expression in patients with bladder transitional cell carcinoma.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
20887962 2010 Adiponectin concentrations: a genome-wide association study.
20876611 2010 Genome-wide association study for adiponectin levels in Filipino women identifies CDH13 and a novel uncommon haplotype at KNG1-ADIPOQ.
20800221 2010 Genome-wide association scan of trait depression.
20732627 2010 Case-control genome-wide association study of attention-deficit/hyperactivity disorder.
20694014 2010 Genome-wide association analyses identifies a susceptibility locus for tuberculosis on chromosome 18q11.2.
20446882 2010 Do candidate genes discriminate patients with an autism spectrum disorder from those with attention deficit/hyperactivity disorder and is there an effect of lifetime substance use disorders?
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20195266 2011 Genomewide pharmacogenomic study of metabolic side effects to antipsychotic drugs.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
20161066 2009 A Fast Implementation of a Scan Statistic for Identifying Chromosomal Patterns of Genome Wide Association Studies.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
20121546 2010 T-cadherin modulates tumor-associated molecules in gallbladder cancer cells.
20090771 2010 Supervised machine learning and logistic regression identifies novel epistatic risk factors with PTPN22 for rheumatoid arthritis.
20039365 2010 A unique interplay between Rap1 and E-cadherin in the endocytic pathway regulates self-renewal of human embryonic stem cells.
20039275 2010 T-cadherin modulates endothelial barrier function.
20030915 2009 [Methylation status of JunB and CDH13 gene promoter in CD34(+)CD38(-) chronic myelogenous leukemia cells].
19955471 2010 Genetic variants identified in a European genome-wide association study that were found to predict incident coronary heart disease in the atherosclerosis risk in communities study.
19799609 2009 Predicting invasive phenotype with CDH1, CDH13, CD44, and TIMP3 gene expression in primary breast cancer.
19726744 2009 T-cadherin is located in the nucleus and centrosomes in endothelial cells.
19638398 2009 Extracellular cadherin repeat domains EC1 and EC5 of T-cadherin are essential for its ability to stimulate angiogenic behavior of endothelial cells.
19581569 2009 Genome-wide association study of alcohol dependence.
19463088 2009 T-cadherin activates Rac1 and Cdc42 and changes endothelial permeability.
19368692 2009 H-cadherin expression reduces invasion of malignant melanoma.
19336575 2009 Genetic analysis of coronary artery disease single-nucleotide polymorphisms in diabetic nephropathy.
19304780 2009 Genome-wide scan identifies CDH13 as a novel susceptibility locus contributing to blood pressure determination in two European populations.
19199263 2009 [Expression of the CDH13 gene and BCR/ABL fusion gene in chronic myeloid leukemia patients and their relationship].
19165155 2009 Genome-wide linkage and association analyses to identify genes influencing adiponectin levels: the GEMS Study.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19116147 2009 Zeb1-mediated T-cadherin repression increases the invasive potential of gallbladder cancer.
18957941 2010 Genome-wide association scan for five major dimensions of personality.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18729198 2008 Promoter hypermethylation of CDH13 is a common, early event in human esophageal adenocarcinogenesis and correlates with clinical risk factors.
18656243 2008 Microarray comparative genomic hybridization analysis of tubular breast carcinoma shows recurrent loss of the CDH13 locus on 16q.
18627351 2008 A requirement for thioredoxin in redox-sensitive modulation of T-cadherin expression in endothelial cells.
18553387 2008 Genetic and epigenetic inactivation of T-cadherin in human hepatocellular carcinoma cells.
18550521 2008 Insights into the low adhesive capacity of human T-cadherin from the NMR structure of Its N-terminal extracellular domain.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18519763 2008 Aneuploidy predicts outcome in patients with endometrial carcinoma and is related to lack of CDH13 hypermethylation.
18425332 2008 Reduced T-cadherin expression and promoter methylation are associated with the development and progression of hepatocellular carcinoma.
18411300 2008 Identification of proteins associating with glycosylphosphatidylinositol- anchored T-cadherin on the surface of vascular endothelial cells: role for Grp78/BiP in T-cadherin-dependent cell survival.
18349282 2008 DNA methylation in tumor and matched normal tissues from non-small cell lung cancer patients.
18337602 2008 DNA methylation markers and early recurrence in stage I lung cancer.
18264096 2008 Multiple loci identified in a genome-wide association study of prostate cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17967182 2007 Identification of a panel of sensitive and specific DNA methylation markers for lung adenocarcinoma.
17960794 2007 Aberrant methylation of E-cadherin and H-cadherin genes in nonsmall cell lung cancer and its relation to clinicopathologic features.
17903302 2007 Framingham Heart Study 100K Project: genome-wide associations for blood pressure and arterial stiffness.
17874043 2007 Adiponectin receptors, with special focus on the role of the third receptor, T-cadherin, in vascular disease.
17873891 2007 Tumor-specific downregulation and methylation of the CDH13 (H-cadherin) and CDH1 (E-cadherin) genes correlate with aggressiveness of human pituitary adenomas.
17765896 2007 Use of multicellular tumor spheroids to dissect endothelial cell-tumor cell interactions: a role for T-cadherin in tumor angiogenesis.
17573778 2007 T-cadherin enhances cell-matrix adhesiveness by regulating beta1 integrin trafficking in cutaneous squamous carcinoma cells.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
17094449 Aberrant methylation is frequently observed in advanced esophageal squamous cell carcinoma.
17077306 2006 Expression of T-cadherin in tumor cells influences invasive potential of human hepatocellular carcinoma.
16873731 2006 Atypical GPI-anchored T-cadherin stimulates angiogenesis in vitro and in vivo.
16602701 2006 Modification-specific proteomics of plasma membrane proteins: identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16273386 2006 An adiponectin receptor, T-cadherin, was selectively expressed in intratumoral capillary endothelial cells in hepatocellular carcinoma: possible cross talk between T-cadherin and FGF-2 pathways.
16222700 2006 p16INK4A and CDH13 hypermethylation in tumor and serum of non-small cell lung cancer patients.
16133358 2006 T-/H-cadherin (CDH13): a new marker for differentiating podocytes.
16099944 2005 T-cadherin protects endothelial cells from oxidative stress-induced apoptosis.
16013438 2005 LDL induces intracellular signalling and cell migration via atypical LDL-binding protein T-cadherin.
15821437 2005 T-cadherin mediates low-density lipoprotein-initiated cell proliferation via the Ca(2+)-tyrosine kinase-Erk1/2 pathway.
15816843 2005 T-cadherin negatively regulates the proliferation of cutaneous squamous carcinoma cells.
15703273 2005 RhoA and Rac mediate endothelial cell polarization and detachment induced by T-cadherin.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364621 2004 T-cadherin upregulation correlates with cell-cycle progression and promotes proliferation of vascular cells.
15292927 2004 Methylation pattern of CDH13 gene in digestive tract cancers.
15251938 2004 Prognostic DNA methylation marker in serum of cancer patients.
15210937 2004 T-cadherin is a receptor for hexameric and high-molecular-weight forms of Acrp30/adiponectin.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14997203 2004 CDH13 promoter region is specifically methylated in poorly differentiated colorectal cancer.
14750164 2004 CDH1 and CDH13 methylation in serum is an independent prognostic marker in cervical cancer patients.
14729458 2004 Cell adhesion molecule T-cadherin regulates vascular cell adhesion, phenotype and motility.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14579115 2003 Polarisation of T-cadherin to the leading edge of migrating vascular cells in vitro: a function in vascular cell motility?
12697869 2003 Cadherin-13, a mediator of calcium-dependent cell-cell adhesion, is silenced by methylation in chronic myeloid leukemia and correlates with pretreatment risk profile and cytogenetic response to interferon alfa.
12489108 2002 Downregulation of expression of a novel cadherin molecule, T-cadherin, in basal cell carcinoma of the skin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12177241 2002 Loss of T-cadherin (CDH13, H-cadherin) expression in cutaneous squamous cell carcinoma.
12060406 2002 Expression of T-cadherin in Basal keratinocytes of skin.
11642747 2001 Recent progress in T-cadherin (CDH13, H-cadherin) research.
11326751 2001 Expression of cell adhesion molecule T-cadherin in the human vasculature.
11027617 2000 The glycosyl phosphatidylinositol anchor of human T-cadherin binds lipoproteins.
10737605 2000 Expression of T-cadherin (CDH13, H-Cadherin) in human brain and its characteristics as a negative growth regulator of epidermal growth factor in neuroblastoma cells.
10601632 1999 LDL binds to surface-expressed human T-cadherin in transfected HEK293 cells and influences homophilic adhesive interactions.
9852687 1998 A GT dinucleotide repeat polymorphism in intron 1 of the H-cadherin (CDH13) gene.
9737784 1998 The H-cadherin (CDH13) gene is inactivated in human lung cancer.
9650591 1998 T-cadherin and signal-transducing molecules co-localize in caveolin-rich membrane domains of vascular smooth muscle cells.
9615235 1998 Localization of human cadherin genes to chromosome regions exhibiting cancer-related loss of heterozygosity.
9468307 1998 Identification of an atypical lipoprotein-binding protein from human aortic smooth muscle as T-cadherin.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8673923 1996 H-cadherin, a novel cadherin with growth inhibitory functions and diminished expression in human breast cancer.
7982033 1994 Cloning of five human cadherins clarifies characteristic features of cadherin extracellular domain and provides further evidence for two structurally different types of cadherin.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.
2059658 1991 Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue.