Property Summary

NCBI Gene PubMed Count 58
PubMed Score 164.33
PubTator Score 111.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (35)

Disease log2 FC p
interstitial lung disease 1.200 3.1e-02
malignant mesothelioma -9.100 3.3e-10
posterior fossa group B ependymoma 1.300 1.8e-05
esophageal adenocarcinoma 2.200 2.4e-02
glioblastoma 1.900 1.7e-02
osteosarcoma 2.872 3.0e-04
cystic fibrosis 2.600 8.9e-03
astrocytoma 1.700 4.0e-02
atypical teratoid / rhabdoid tumor -1.900 2.1e-04
medulloblastoma, large-cell -1.600 5.8e-03
Duchenne muscular dystrophy 1.804 3.3e-09
autosomal dominant Emery-Dreifuss muscul... 1.348 1.4e-02
juvenile dermatomyositis 1.421 2.9e-08
limb girdle muscular dystrophy 2B 1.051 1.4e-02
acute quadriplegic myopathy 1.679 2.2e-04
primary pancreatic ductal adenocarcinoma 4.650 4.2e-05
X-linked cerebral adrenoleukodystrophy 1.500 3.5e-02
colon cancer 1.600 4.3e-02
active Crohn's disease 2.949 1.3e-03
sarcoidosis 1.400 3.6e-03
pancreatic cancer 4.600 3.0e-05
Breast cancer 3.900 3.0e-02
interstitial cystitis -1.200 7.0e-03
pediatric high grade glioma 1.400 2.4e-04
pilocytic astrocytoma 2.000 6.5e-07
primary Sjogren syndrome 1.500 1.6e-03
invasive ductal carcinoma 1.700 7.9e-04
nasopharyngeal carcinoma 1.200 6.2e-03
lung adenocarcinoma 1.023 2.5e-03
lung carcinoma -2.300 2.3e-16
gastric carcinoma 2.400 5.8e-03
ductal carcinoma in situ 2.000 4.0e-03
ulcerative colitis 3.100 1.3e-06
ovarian cancer -4.200 1.4e-08
pituitary cancer -2.300 1.3e-04

Gene RIF (42)

PMID Text
26706910 Upregulation of miR-27b significantly accelerated the proliferation, cell cycle transition from G1 to S phase, migration and invasion of C33A cells, while downregulation of miR-27b suppressed the proliferation and invasion of HeLa cells
26519476 observations suggest that clathrin-mediated internalization of Cad11 regulates surface trafficking of Cad11 and that dynamic turnover of Cad11 regulates the migratory function of Cad11 in prostate cancer cells.
26476273 that U87-p75(NTR) cells express higher levels of Cdh-11 protein and that siRNA-mediated knockdown of Cdh-11 resulted in a significant decrease in p75(NTR)-mediated glioblastoma cell migration
26121083 Cadherin-11 may be hyper-expressed in the peripheral blood of diffuse systemic scleroderma patients.
26092671 High Cad-11 expression is associated with bone metastases of Ewing sarcoma.
26046821 Invasive cancer cells had increased expression of mesenchymal markers cadherin 2 and 11 that localized with stromal cell cadherin 11, suggesting that these molecules are involved in stromal cell engraftment.
25919928 Data suggest methylation status of gene promoters for CDH11 (cadherin 11) and BASP1 (brain abundant membrane attached signal protein 1) in tumor, skin, and metastatic tumor tissue may serve as prognostic biomarkers in patients with advanced melanoma.
25771201 Existing knowledge regarding the role of CDH2 and CDH11 during development and differentiation in vivo and in vitro is reviewed. [review]
25173800 This study evaluated the expression of CAD11 in the peripheral blood of rheumatoid arthritis patients and normal controls.
24940649 Cadherin 11, a miR-675 target, induces N-cadherin expression and epithelial-mesenchymal transition in melasma.
24839052 evidence for the involvement of CDH11 in Autism Spectrum Disorder which is consistent with the association of other cadherins with Autism Spectrum Disorder and neuropsychiatric diseases
24757152 These data demonstrate that Cad-11 is a mediator of dermal fibrosis and TGFbeta production and suggest that Cad-11 may be a therapeutic target in systemic sclerosis.
24681547 High Cadherin-11 expression is associated with breast cancer.
24648356 Our results demonstrate that parathyroid hormone stimulates hematopoiesis through promoting the upregulation of CDH11 expression in bone marrow mesenchymal stromal cells
24574497 Data indicate that the interaction of mesenchymal stem cells (MSC) with fibroblast-like synoviocytes (FLS) via cadherin-11 may contribute to angiogenesis and chronic synovitis by enhancing the secretion of placental growth factor (PlGF).
23971040 Thus, our results indicated abnormal expression of CD44V6, CDH11, and beta-catenin in osteosarcomas and osteochondromas, which may provide important indicators for further research.
23951053 Data indicate that knockdown of CDH11 expression in primary human glioblastoma cells inhibits TGFbeta-stimulated migration.
23162011 Results indicate the necessity of cadherin-11 for dystrophic calcific nodule formation, which proceeds through an Erk1/2-dependent pathway.
22374749 The study of CDH11 5'-CpG island hypermethylation in primary tumours and lymph node metastases of cancer patients showed this epigenetic alteration to be significantly confined to the disseminated cells.
22267545 These results show the functional significance of cadherin-11 expression in glioblastoma multiforme.
22139084 Data indicate that CDH11 as a functional tumor suppressor and an important antagonist of Wnt/beta-catenin signaling, with frequent epigenetic inactivation in common carcinomas.
21990376 CDH11 expression was assessed in lung tissue from idiopathic pulmonary fibrosis patients.
21798287 increased expression in patients with rheumatoid arthritis
21722156 CDH11 as a novel glioma invasion-associated candidate gene that likely contribute to the invasive phenotype of malignant gliomas.
21536877 cad-11 modulates synovial fibroblasts to evoke inflammatory factors that may contribute to the inflammatory process in RA.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19996288 suppression of MUC1 by miR-145 causes a reduction of beta-catenin as well as the oncogenic cadherin 11
19339270 Observational study of gene-disease association. (HuGE Navigator)
19274078 Cadherin-11 mRNA and protein levels are regulated by the activity of GSK3beta and a significant degree of this regulation is exerted by the GSK3 target, beta-catenin, at the level of the cadherin-11 3'UTR
19133007 Cadherin-11 and fascin might be useful markers for recurrence of pleomorphic adenomas.
18821672 Tumor necrosis factor alpha drives cadherin 11 expression in rheumatoid inflammation
18708358 These findings suggest that cadherin-11 is involved in the metastasis of prostate cancer cells to bone.
18575746 cadherin-11 promotes homing and migration to bone and osteoclastogenesis through mediating the homophilic interactions of breast cancer cells with marrow stromal/osteoblastic cells, thereby enhancing bone metastases.
18359978 The results indicate that CDH11 may be useful as a prognostic marker of disease progression and survival in osteosarcoma.
18193170 Overexpression of osteoblast cadherin is associated with breast cancer cell metastatic potential
17292535 Cadherin-11 is involved in the intercellular physical coupling of detrusor smooth muscle bladder cells and also of myofibroblasts.
16651616 Together, these studies implicate cadherin-11 in synovial tissue and lining layer formation and provide an in vitro system to model fibroblast-like synoviocyte behavior and function in organizing the synovial tissue.
15743489 Review. Cadherin-11 expression confers upon cells a fundamental change in cellular behavior. Its expression on fibroblast-like synoviocytes may determine their behavior & differentiation.
15509545 primary aneurysmal bone cysts are mesenchymal neoplasms exhibiting USP6 and/or CDH11 oncogenic rearrangements
15383628 A 2.62 Mbp minimal region of genomic loss of chromosome 16q22 was found in retinoblastoma which contains a hotspot CDH11, implicating CDH11as a potential tumor suppressor gene in retinoblastoma.
14985702 CADH11 was evaluated as a biomarker at the protein level and was found to have increased expression in xenograft tumors after S11248 treatment.
11775026 The intracellular domain of cadherin-11 is not required for the induction of cell aggregation, adhesion or gap-junction formation

AA Sequence

MKENYCLQAALVCLGMLCHSHAFAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQFFVIEEYTGPD      1 - 70
PVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRDTNRPLE     71 - 140
PPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQVTASDADDPTYGNSAKLVYSILEGQPYFSV    141 - 210
EAQTGIIRTALPNMDREAKEEYHVVIQAKDMGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEA    211 - 280
AVPGEEVGRVKAKDPDIGENGLVTYNIVDGDGMESFEITTDYETQEGVIKLKKPVDFETKRAYSLKVEAA    281 - 350
NVHIDPKFISNGPFKDTVTVKISVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIRYS    351 - 420
IDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVPVAIRVLDVNDNAPKFAA    421 - 490
PYEGFICESDQTKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGF    491 - 560
SRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLSTGALIAILACIVIL    561 - 630
LVIVVLFVTLRRQKKEPLIVFEEEDVRENIITYDDEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEY    631 - 700
QYMPRPGLRPAPNSVDVDDFINTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYD    701 - 770
YLQNWGPRFKKLADLYGSKDTFDDDS                                                771 - 796
//

Text Mined References (61)

PMID Year Title
26706910 2016 miR-27b is upregulated in cervical carcinogenesis and promotes cell growth and invasion by regulating CDH11 and epithelial-mesenchymal transition.
26519476 2015 Cadherin-11 endocytosis through binding to clathrin promotes cadherin-11-mediated migration in prostate cancer cells.
26476273 2015 Gamma-secretase-independent role for cadherin-11 in neurotrophin receptor p75 (p75(NTR)) mediated glioblastoma cell migration.
26121083 Increased messenger RNA levels of the mesenchymal cadherin-11 in the peripheral blood of systemic sclerosis patients correlate with diffuse skin involvement.
26092671 2015 Cadherin-11 regulates the metastasis of Ewing sarcoma cells to bone.
26046821 2015 Enhanced Adhesion of Stromal Cells to Invasive Cancer Cells Regulated by Cadherin 11.
25919928 2015 Novel DNA methylation markers with potential prognostic relevance in advanced malignant melanoma identified using COBRA assays.
25771201 2015 CDH2 and CDH11 act as regulators of stem cell fate decisions.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25173800 2014 Cadherin-11 mRNA transcripts are frequently found in rheumatoid arthritis peripheral blood and correlate with established polyarthritis.
24940649 2014 Cadherin 11, a miR-675 target, induces N-cadherin expression and epithelial-mesenchymal transition in melasma.
24839052 2014 Association of CDH11 with non-syndromic ASD.
24757152 2014 Identification of cadherin 11 as a mediator of dermal fibrosis and possible role in systemic sclerosis.
24681547 2014 Cadherin-11 in poor prognosis malignancies and rheumatoid arthritis: common target, common therapies.
24648356 2014 Parathyroid hormone enhances hematopoietic expansion via upregulation of cadherin-11 in bone marrow mesenchymal stromal cells.
24574497 2014 Interaction of mesenchymal stem cells with fibroblast-like synoviocytes via cadherin-11 promotes angiogenesis by enhanced secretion of placental growth factor.
23971040 2013 The prognostic significance of CD44V6, CDH11, and ?-catenin expression in patients with osteosarcoma.
23951053 2013 Cadherin-11 regulates motility in normal cortical neural precursors and glioblastoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23162011 2013 Cadherin-11 regulates cell-cell tension necessary for calcific nodule formation by valvular myofibroblasts.
22374749 2012 Epigenetic disruption of cadherin-11 in human cancer metastasis.
22267545 2012 Cadherin-11, a marker of the mesenchymal phenotype, regulates glioblastoma cell migration and survival in vivo.
22139084 2012 The human cadherin 11 is a pro-apoptotic tumor suppressor modulating cell stemness through Wnt/?-catenin signaling and silenced in common carcinomas.
21990376 2012 Cadherin-11 contributes to pulmonary fibrosis: potential role in TGF-? production and epithelial to mesenchymal transition.
21798287 2011 IL-17 increases cadherin-11 expression in a model of autoimmune experimental arthritis and in rheumatoid arthritis.
21722156 2012 Identification and functional validation of CDH11, PCSK6 and SH3GL3 as novel glioma invasion-associated candidate genes.
21536877 2011 Cadherin-11 regulates fibroblast inflammation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19996288 2010 MicroRNA-145 suppresses cell invasion and metastasis by directly targeting mucin 1.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19274078 2009 Post-transcriptional regulation of cadherin-11 expression by GSK-3 and beta-catenin in prostate and breast cancer cells.
19133007 2008 Recurrence of pleomorphic adenoma of the parotid gland--predictive value of cadherin-11 and fascin.
18821672 2008 Tumor necrosis factor alpha drives cadherin 11 expression in rheumatoid inflammation.
18708358 2008 Cadherin-11 promotes the metastasis of prostate cancer cells to bone.
18575746 2008 Cadherin-11-mediated interactions with bone marrow stromal/osteoblastic cells support selective colonization of breast cancer cells in bone.
18359978 CDH11 expression is associated with survival in patients with osteosarcoma.
18193170 2008 Alterations in Cx43 and OB-cadherin affect breast cancer cell metastatic potential.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17292535 2007 Cadherin-11 is expressed in detrusor smooth muscle cells and myofibroblasts of normal human bladder.
16651616 2006 Cadherin-11 induces rheumatoid arthritis fibroblast-like synoviocytes to form lining layers in vitro.
15743489 2005 Building the synovium: cadherin-11 mediates fibroblast-like synoviocyte cell-to-cell adhesion.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15509545 2004 USP6 and CDH11 oncogenes identify the neoplastic cell in primary aneurysmal bone cysts and are absent in so-called secondary aneurysmal bone cysts.
15383628 2004 Minimal 16q genomic loss implicates cadherin-11 in retinoblastoma.
15026324 2004 USP6 (Tre2) fusion oncogenes in aneurysmal bone cyst.
14985702 2004 Gene expression profiling of human colon xenograft tumors following treatment with SU11248, a multitargeted tyrosine kinase inhibitor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14625392 2003 A novel cell-cell junction system: the cortex adhaerens mosaic of lens fiber cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10760957 2000 Differential regulation of cadherins by dexamethasone in human osteoblastic cells.
10550312 1999 Anomalous cadherin expression in osteosarcoma. Possible relationships to metastasis and morphogenesis.
10398117 1999 Functional loss of E-cadherin and cadherin-11 alleles on chromosome 16q22 in colonic cancer.
10320525 1999 Expression and function of the splice variant of the human cadherin-11 gene in subordination to intact cadherin-11.
10029089 1999 Cadherin-11 is expressed in invasive breast cancer cell lines.
9615235 1998 Localization of human cadherin genes to chromosome regions exhibiting cancer-related loss of heterozygosity.
9520111 1998 Regulated expression of cadherin-6 and cadherin-11 in the glandular epithelial and stromal cells of the human endometrium.
8163513 1994 Molecular cloning and characterization of OB-cadherin, a new member of cadherin family expressed in osteoblasts.
7982033 1994 Cloning of five human cadherins clarifies characteristic features of cadherin extracellular domain and provides further evidence for two structurally different types of cadherin.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.
2059658 1991 Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue.