Property Summary

NCBI Gene PubMed Count 1,477
PubMed Score 5832.33
PubTator Score 5377.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 1.0
Carcinoma 2147 0.0 1.0
Disease Target Count
Breast cancer, lobular 1

Expression

  Differential Expression (17)

Disease log2 FC p
ovarian cancer 2.500 3.5e-03
ulcerative colitis -1.200 4.8e-03
malignant mesothelioma 1.500 1.9e-06
psoriasis 1.900 2.8e-04
osteosarcoma -4.624 3.6e-07
atypical teratoid / rhabdoid tumor 2.400 1.4e-02
primitive neuroectodermal tumor 1.800 3.1e-02
non-small cell lung cancer 1.678 9.3e-12
lung cancer 1.100 4.9e-03
interstitial cystitis -2.600 1.1e-04
adult high grade glioma 1.300 2.4e-02
group 4 medulloblastoma 1.900 4.6e-04
pilocytic astrocytoma 2.800 1.7e-07
lung adenocarcinoma 1.559 3.2e-04
lung carcinoma 1.300 1.1e-22
ductal carcinoma in situ 3.400 1.4e-02
invasive ductal carcinoma 3.700 3.7e-02
See source...

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651862 confirmatory 5 / 0 / 1 Small Molecules that Restore E-cadherin Expression

Gene RIF (1424)

PMID Text
27273957 Progressive loss of e-cadherin/alpha-catenin expression is associated with an aggressive phenotype (low differentiation, increased metastatic activity/advanced stage) in thyroid carcinomas.
27067410 CDH1 promoter methylation can be a potential biomarker in ovarian cancer risk prediction. [meta-analysis]
27048119 TWIST2 regulates epithelial-mesenchymal transition by depriving the epithelial cell phenotype of E-cadherin and endowing the mesenchymal cell phenotype with Vimentin, which may be involved in the progression and prognosis of ovarian cancer.
26927545 Data suggest that microRNA miR-101 may inhibit MDA-MB-231 breast cancer cell proliferation and migration by repressing DNA methyltransferase 3a (DNMT3a) expression and up-regulating E-cadherin expression.
26927375 Data show that grape seed proanthocyanidins could inhibit cell proliferation, invasion and migration of A549 cells, which might be related to the down-regulation of epidermal growth factor receptor and N-cadherin and the up-regulation of E-cadherin.
26901067 Truncating somatic alterations in the CDH1 gene occur in 84% of plasmacytoid carcinomas and are specific to this histologic variant.
26897964 EZH2 mediates the regulation of E-cadherin expression by S100A4 and controls the proliferation and migration of gastric cancer cells.
26855131 Collectively, using tetraspanin CD9 in tandem with E-cadherin as a biomarker in renal cell carcinoma will help to not only distinguish between types, but also predict the metastatic potential of RCC.
26847082 These metastatic tumors revealed no detectable expression of CK8/18, E-cadherin, VCAM-1, and ICAM-1
26842802 Findings indicated that HIF-2alpha promotes epithelial-mesenchymal transition in pancreatic cancer by regulating Twist2 binding to the promoter of E-cadherin.
26819089 E-cadherin expression is down-regulated in colon cancer cells through inactivation of UTX.
26810856 As a consequence, Slug transcription is down-regulated relieving A549 cells from Slug-mediated repression of E-cadherin transcription, thereby diminishing the metastatic potential of these oncogenic Ras-expressing NSCLC cells
26758745 Evaluation of FoxC2 expression, alone or in combination with E-cadherin expression, may help to stratify non-small cell lung cancer patients for risk of disease progression, pointing to this EMT regulator as a potential prognostic marker
26757261 Calpain-mediated E-Cadherin fragmentation appears to promote intraperitoneal epithelial ovarian cancer progression.
26746659 High E-cadherin concentration in presence of enhanced gamma-secretase activity is incontestably a paradoxically result, highlighting that E-cadherin loss is not a pre-requisite for Epithelial-Mesenchymal Transition.
26742007 CDH1 expression is lost in 52% of colorectal carcinomas in this cohort.
26724145 Differential membranous E-cadherin expression, cell proliferation and O-GlcNAcylation in metastatic nodal lesion compared to primary colorectal carcinoma may play role in establishing these lesions.
26708505 LOC389641 promotes pancreatic ductal adenocarcinoma progression and increases cell invasion by regulating E-cadherin with the possible involvement of TNFRSF10A.
26708270 The present study therefore indicated that IL-6 promoted the process of EMT in HIBECs as characterized by increased migration and invasion of HIBECs and the typical changes in mRNA and protein expression of the EMT markers E-cadherin and vimentin.
26707622 OGT inhibited the formation of the Ecadherin/catenin complex through reducing the interaction between p120 and Ecadherin.
26704932 The role of soluble E-cad in tumorigenesis and tumor progression and its significance in clinical therapeutics. [review]
26702618 These data suggest that the number of polyploid giant cancer cells and the EMT-related proteins E-cadherin, N-cadherin, and vimentin may be valuable biomarkers to assess metastasis in patients with breast cancer.
26701804 downregulation of PDLIM1 in colorectal cancer samples correlated with reduced E-cadherin and membrane beta-catenin levels
26689197 MTA1 plays an important role in Epithelial-to-mesenchymal transition (EMT) to promote metastasis via suppressing E-cadherin expression, resulting in a poor prognosis in MPM. MTA1 is a novel biomarker and indicative of a poor prognosis in MPM patients
26684027 Loss of E-cadherin disrupts ovarian epithelial inclusion cyst formation and collective cell movement in ovarian cancer.
26674321 H3K36me3 correlates with increased skipping of the final 83 base pairs of CDH1 exon 8 in gastric cancer cell lines
26617803 PTTG2 induces psoriasis by regulating epidermal expression of vimentin and E-cadherin.
26548607 UHRF1 promotes osteosarcoma cell invasion by downregulating the expression of Ecadherin and increasing epithelialtomesenchymal transition in an Rb1dependent manner.
26540342 Data show that telomerase (hTERT) and ZEB1 protein form a complex, which directly binds to the E-cadherin promoter, and then inhibits E-cadherin expression and promotes epithelial-to-mesenchymal transition (EMT) in colorectal cancer cells.
26530812 These data suggest that targeting the IL-8/AKT1 signaling pathway and DNMT1 may provide a potential therapeutic approach for blocking NPC metastasis.
26491048 CUGBP1 and HuR negate each other's effects in regulating E-cadherin translation by altering the recruitment of E-cadherin mRNA to PBs and play important roles in the regulation of intestinal barrier integrity.
26490105 Upregulation of E12/E47 by HBx ultimately and concomitant repression of E-cadherin expression led to epithelial-mesenchymal transition in human hepatocytes.
26484421 The CDH1 +54C/T was associated with susceptibility to endometriosis in Iranian population, and +54T allele may have a protective role in progression of endometriosis.
26470691 Demonstrate that HBx-HCCR-E-cadherin regulation pathway might play an important role in HBV-induced hepatocarcinogenesis.
26464646 expression of E-cadherin, and p120 negatively correlated with the tumor differentiation of oral squamous cell carcinoma.
26443527 Prophylactic laparoscopic total gastrectomy with jejunal pouch reconstruction in patients with CDH1 germline mutation is feasible with 82% of patients having intramucosal diffuse gastric signet ring cell carcinoma in the resection specimen.
26368311 Data show that myosin II supports a stable Rho zone at the at E-cadherin junctions.
26334393 miR-200b represses esophageal squamous carcinoma cell invasion in vivo without altering the expression of E-cadherin.
26334097 analysis of ARID1A, CDH1, cMET and PIK3CA expression and target-related microRNA expression in gastric cancer
26320173 factor:TAZ transcriptional co-activator and activation of sE-Cadherin/proto-oncogene protein HER-2 signaling could be potential oncogenic pathways for breast cancer (BC) metastasis.
26302406 PLEKHA7 localization to adherens junctions is E-cadherin and p120 dependent.
26299056 In patients with breast infiltrating ductal carcinoma, E-cadherin expression was observed conserved in most of the tumors, 92.5% of cases
26289297 Epithelial cells with disrupted E-cadherin gene retain the ability to form cell junctions and apico-basal polarity.
26285011 genetic polymorphisms of CDH1 and CTNNB1 were associated with breast cancer susceptibility and patients' prognosis
26280083 These data show that MTBP aggravates the invasion and metastasis of HCC by promoting the MDM2-mediated degradation of E-cadherin.
26262813 in the NMA cases, none of these factors was statistically significant. In a univariate analysis, neither EGFR nor E-cadherin expression showed a significant impact on disease-free or overall survival.
26226776 Combined therapy with cytotoxic and anti-VEGF agents was shown to result in a significant increase in the number of cases of normal membrane localization of E-cadherin as compared with control (p = 0.00043) and cytotoxic therapy-alone (p = 0.01) groups
26204886 CDH1 and IL1-beta expression dictates FAK and MAPKK-dependent cross-talk between cancer cells and human mesenchymal stem cells
26198055 CDH1 is reduced in endometriosis.
26195669 E-cadherins arrange in ordered clusters; the first demonstration of the existence of oligomeric cadherins at cell-cell contacts.
26194050 results indicate Moesin may regulate cell motility through its interactions with MT1-MMP and E-cadherin/p120-catenin adhesion complex and cytoplasmic expression of Moesin correlates with nodal metastasis and poor prognosis of OSCCs
26191293 CDH1 polymorphism in -347G-->GA was observed to be associated with susceptibility of pancreatic cancer
26191276 There were differences in the expression of Nrf2, Keap1, p16 and E-cadherin between different ovarian carcinoma subtypes.
26189796 site-specific E-cadherin glycosylation modification can directly modulate E-cadherin mediated cell-cell adhesion, a key pathophysiological event in gastric cancer progression.
26182300 Report role of CDH1 mutations in estimates of age-associated risks of gastric and breast cancer.
26175155 the allosteric regulation of cell surface E-cadherin by p120(ctn) dephosphorylation.
26149475 Decreased membranous E-cadherin expression and aerogenous spread may be associated with worse disease-free survival.
26134113 SFN inhibited invasion by activating ERK1/2 to upregulate E-cadherin and downregulate CD44v6, thereby reducing MMP-2 expression and activity. E-cadherin is an invasion inhibitor, while CD44v6 and MMP-2 are invasion promoters
26133979 ZIP5 knockdown inhibited the proliferation, migration and invasion of ESCC and suppressed COX2, cyclin D1 and E-cadherin expression, which led to the inhibition of cell progression in esophageal squamous cell carcinoma .
26125777 expression. E-cadherin may play a significant role in the sensitivity regulation of EGFR molecular targeting treatment. E-cadherin may provide important clues for selecting proper EGFR-TKI molecular targeting treatment
26123647 We concluded that CDH1 contributes to NSCL/P with mainly rare, moderately penetrant variants, and CDH1 haploinsufficiency is the likely etiological mechanism.
26097606 Suggest ECAD expression as independent prognostic factor in colorectal carcinoma.
26078714 Demethylase recovered CDH1 gene expression may be involved in the apoptosis process. The beta-catenin protein translocated from the nucleus and cytoplasm to the membrane result in inactivation of b-catenin signaling pathway
26072394 All individuals with a CDH1 mutation had a personal or family history of diffuse gastric cancer. Patients with gastric cancer and germline CDH1 mutations had shorter survival times than patients who met the HDGC criteria but did not have CDH1 mutations.
26047787 Particulate matter (PM10) downregulates E-Cadherin/beta-Catenin expression.
26045832 E-cadherin and vimentin positive expression was associated with tumor metastasis of oral squamous cell carcinoma
26045824 E-cadherin expression was associated with EGFR mutation status and patient prognosis in lung adenocarcinoma patients
26039245 Univariate analyses showed that AR, CDH1 and Ki-67 expression levels were significantly associated with overall survival in triple-negative breast cancer patients.
26032781 Report association between human papillomavirus and Epstein - Barr virus DNA and gene promoter methylation of RB1 and CDH1 in range of cervical lesions.
25998224 knockdown of ILK inhibits glioma cell migration, invasion and proliferation through upregulation of E-cadherin and downregulation of cyclin D1. Our results suggest that ILK may serve as a promising therapeutic target for glioma.
25988855 Results suggest a regulatory function of E-cadherin that modulates Nrg1 signaling and promotes Schwann cell myelin formation
25976617 our results revealed that activation of the P2X7 receptor by ATP promotes breast cancer cell invasion and migration, possibly via activation of the AKT pathway and regulation of E-cadherin and MMP-13 expression.
25975373 the expression levels of HIF1a, Snail and Ecadherin were correlated with clinical pathological factors in human ovarian cancer.
25967717 In the cascade of gastric carcinoma development, an association was found with loss of E-cadherin.
25967040 sE-cadherin performed most favorably from a large panel of serum proteins in terms of diagnostic and predictive potential in curatively treatable PCa.
25962181 Cyclin B1 could suppress the invasion and metastasis of colorectal cancer cells through regulating E-cadherin expression, which enables the development of potential intervention strategies for colorectal cancer.
25957200 The results of the present study point to a new direction to pharmacologically accelerate corneal re-epithelialization, and should have salient clinical implication.
25955302 The combined expression of ezrin(high) and E-cad(low) or ezrin(high) and ezrin(c) was more associated with lymph node metastasis and poor prognosis. I
25926721 CDH1 hypermethylation is correlated with Helicobacter pylori status, indicating that it plays a more important role in the pathogenesis of Helicobacter pylori-positive gastric cancer
25908636 expression and promoter methylation status in colon adenocarcinoma
25904157 In patients with placenta accreta, extravillous trophoblasts (EVT) closer to the placental-myometrial interface demonstrated less E-CAD staining than those found deeper in the myometrium.
25896413 To increased E-cadherin expression and decreased Akt phosphorylation.
25879941 Nuclear factor I-C regulates E-cadherin via control of KLF4 in breast cancer
25875782 MicroRNA-10b Triggers the Epithelial-Mesenchymal Transition (EMT) of Laryngeal Carcinoma Hep-2 Cells by Directly Targeting the E-cadherin.
25874772 The de-regulation of both of miR-29b/c and DNMT3A leads to the epigenetic silencing of CDH1 and contributes to the metastasis phenotype in gastric cancer.
25873087 We demonstrate the potential of common inherited genetic variants to inform patient outcome and show that cdh1's rs9929218 identifies approximately 8% of colorectal cancer patients with poor prognosis.
25871475 E-Cadherin under-expression is associated with hepatic carcinoma.
25870236 findings demonstrate MPP8 and SIRT1 reciprocally regulate each other's function at multiple molecular layers through physical interaction; disruption of MPP8-SIRT1 interaction de-represses E cadherin expression and reduces cell motility and invasiveness suggesting this interplay plays critical role in MPP8- and SIRT1-mediated epithelial-mesenchymal transition
25869072 This study shows that TGF-alpha uses common and divergent molecular mediators to regulate E-cadherin expression and cell invasion.
25826491 E-cadherin and CD44 may have a role in the epithelial-mesenchymal transition of bladder urothelial carcinomas
25822802 Negative E-cadherin expression in bone and soft tissue sarcomas was correlated with lower 5-year overall survival (OR = 3.831; 95% CI: 2.246-6.534), and was associated with higher clinical stage. Meta-analysis.
25810011 ABCG2 localizes to the nucleus and modulates CDH1 expression in lung cancer cells
25803827 It was shown that both E- and N-cadherin mRNA and protein are expressed in the human renal proximal tubule.
25771876 The germline missense mutant CDH1(Q16H) had a pro-invasive cell behavior.
25758127 EHD2 can inhibit the metastasis of human breast cancer by regulating the epithelial-to-mesenchymal transition markers E-cadherin and N-cadherin.
25758052 The results from the current study indicate that the hypermethylation frequency of E-cadherin in NSCLC is strongly associated withnon-small cell lung carcinoma incidence and it may be an early event in carcinogenesis
25743258 Hypermethylation of Integrin alpha4 is associated with Prostate Cancer.
25736925 C6orf106 promotes invasion in NSCLC cells. Finally, C6orf106 upregulates vimentin, and downregulates E-cadherin and P120ctn.
25736499 spatial polarization of integrin and E-cadherin adhesions in a human pluripotent stem cell colony compete to recruit Rho-ROCK activated myosin II.
25694126 miR-218 and its downstream target Gli2, as well as E-cadherin, participate in the anti-invasion process
25672609 These findings indicated that increased SUZ12 promote gastric cancer cell proliferation and metastasis partly via repressing KLF2 and E-cadherin transcription.
25667455 E-Cadherin expression in primary sites positively correlates with E-cadherin from LNM
25651564 that MAD2B may play an important role in high glucose-mediated podocyte injury of diabetic nephropathy via modulation of Cdh1, cyclin B1, and Skp2 expression
25649870 Results showed evidence that Wip1 underwent Cdh1-dependent proteolysis during mitosis and sustained Wip1 activity during mitosis, resulting in mitotic delay at the metaphase to anaphase transition.
25648022 CDH1 germline variants are present in early-onset diffuse gastric cancer patients in Chinese population, but they are mainly missense variants with unknown function which are likely associated with lymph node metastasis and survival.
25630770 RhoB depletion reduces cell-cell adhesion and downregulates E-cadherin levels as well as increasing internalized E-cadherin in DU145 prostate cancer cells.
25620178 The positive expression of E-cad and anti-apoptosis Bcl-2 protein are negatively related in breast cancer.
25619476 GPC3 and E-cadherin expressions are not independent prognostic factors in CRC.
25613741 alleles of marker rs10431924 of the CDH1 gene are associated with vitiligo, especially in the presence of autoimmune comorbidities
25613390 Low CDH1 contributes to endometrial cancer progression.
25611270 The immunohistochemical expression of E-cadherin and alpha-smooth muscle actin (alpha-SMA) in 15 cases of pleomorphic adenoma of salivary glands, were investigated.
25607384 The aim of this study was to investigate immunohistochemically the E-cadherin/N-cadherin "switch" and vimentin expression as markers of epithelial-mesenchymal transition process in tongue oral squamous cell carcinomas.
25602697 Suggest MelanA-negative spindle-cell associated melanoma constitutes a distinct inflammatory phenotype correlated with dense infiltration of CD163 macrophages and loss of E-cadherin.
25599647 this meta-analysis failed to confirm the association between the CDH1 C-160A polymorphism and risk of gastric cancer.
25590779 Cytoskeletal regulation plays in controlling the levels of intra-junctional tension at E-cadherin junctions.
25563818 Results show that telomere shortening is closely associated with severity of Helicobacter pylori-induced gastritis and CDH1 methylation status.
25553984 Serum soluble E-cad level is an independent prognostic factor in Asian breast cancer patients.
25542234 the decrease in E-cadherin and/or increase in N-cadherin may be required for BMP4-induced migration and EMT.
25538040 self-renewal versus differentiation of human ESCs (hESCs) in response to Wnt signaling is predominantly determined by a two-layer regulatory circuit involving beta-catenin, E-cadherin, PI3K/Akt, and Slug in a time-dependent manner.
25535613 This review focuses on soluble E-cadherin in sera of patients affected by three solid cancers (breast, gastric, and colorectal cancers) and how its levels correlate or not with some cancer parameters
25534349 Exogenous expression of cell surface E-cadherin converts statin- sensitive cells to a partially resistant state implying that statin resistance is in part dependent on the tumor cells attaining an epithelial phenotype
25533808 Overexpression of SPRY2 reduced EGF-induced cell invasion by attenuating EGF-induced E-cadherin down-regulation
25514034 ERbeta1 inhibits the migration and invasion of breast cancer cells and upregulated E-cadherin expression in a Id1-dependent manner.
25509356 We examined allelic imbalance (AI) on loci 17p13.1 (TP53), 1p36.1 (RUNX) and 16p22 (CDHI) and microsatellite instability (MI) with BAT26 in 78 patients with gastric cancer
25486483 epithelial cell-derived periostin exerts tumor-suppressor activities in gastric cancer through stabilizing p53 and E-cadherin proteins via the Rb/E2F1/p14(ARF)/Mdm2 signaling pathway.
25471088 placental level significantly reduced in placenta percreta
25468996 The E-cadherin intracellular interactome is predominantly independent of cell-cell adhesion.
25449012 Results suggest that, besides their role in mechanical adhesion, loss of E-cadherin expression may contribute to cancer progression by modifying pathways that regulate fundamental processes as oxidative stress, immune evasion and cell metabolism.
25447306 The expression of E-cadherin varied with breast carcinoma progression to bone metastasis leading to an epithelial phenotype.
25446087 TLE1 has a role in regulating epithelial-to-mesenchymal transition in A549 cells through its repressive effect on E-cadherin
25445115 Suggest that loss of PEAK1/E-cadherin may play an important role in carcinogenesis and development of gastric cancer through activating epithelial to mesenchymal transition.
25441488 Loss of E-cadherin expression is associated with recurrence in gastric cancer.
25433496 The T-box transcription factor Brachyury promotes renal interstitial fibrosis by repressing E-cadherin expression
25420671 Octamer-binding protein 4 affects the cell biology and phenotypic transition of lung cancer cells involving beta-catenin/E-cadherin complex degradation
25395582 data suggests that E-cadherin regulates assembly of nectin junctions through alpha-catenin-induced remodeling of the actin cytoskeleton around the cadherin clusters.
25388006 Our results suggest employing this methodology as a complementary approach to evaluate the pathogenicity of E-cadherin missense variants
25386896 CD148 tyrosine phosphatase promotes e-cadherin cell adhesion.
25380749 high osteopontin but low E-cadherin expression can be considered as a negative, independent prognostic factor in patients with locally advanced cervical squamous cell carcinoma
25379974 The results of this study support the role of E-cadherin in the pathogenesis of asthma.
25375090 MicroRNA-9 has a role in promoting tumor metastasis via repressing E-cadherin in esophageal squamous cell carcinoma
25374218 High E-cadherin expression is associated with oral squamous cell carcinoma.
25362514 low expression in hepatocellular carcinoma
25360740 NKX3.1 expression mediate beta-catenin and E-cadherin association and cell migration in prostate cells.
25349192 Cdh1 depletion causes increased levels of genomic instability and enhanced sensitivity to DNA-damaging agents.
25340495 Observed strong association of promoter hypermethylation of CDH1 with Gastric cancer(OR = 12.23) suggesting that epigenetic regulation of CDH1 could play a critical role in the etiology of Gastric cancer.
25340348 E-cadherin binding is essential for the barrier disruption with the Clostridium botulinum type B hemagglutinin complex
25333347 PDGFD, CDH1 and SLIT2 are upregulated in low grade meningiomas and schwannomas compared with healthy tissue.
25332147 In this critical review, we describe the clinical management of CDH1 germline mutant carriers providing specific recommendations for genetic counselling, clinical criteria, surveillance and/ or prophylactic surgery.
25329121 This study focused on analyzing the immunoexpression of CK19, vimentin and E-cadherin in a number of 43 differentiated thyroid carcinomas.
25317805 In this meta-analysis, E-cadherin expression predicts the overall survival and tumor metastasis in Asian patients with gastric cancer.
25315069 deltaEF1 associates with DNMT1 and maintains DNA methylation of the E-cadherin promoter in breast cancer cells.
25304374 AKR1B10 is a unique enzyme involved in pancreatic carcinogenesis via modulation of the Kras-E-cadherin pathway.
25282623 E-cadherin and CD10 in endometrial lesions is not correlated, but reduced expression of both molecules could be critical for progression of endometrial carcinoma
25282138 In this cohort of NPC patients, higher levels of E-cadherin and higher levels of vimentin were associated with worse outcomes
25277393 results demonstrate that adhesion of beta-cells to E- and N-cadherins is regulated by insulin secretagogues and that E- and N-cadherin engagement promotes stimulated insulin secretion.
25260805 Abnormal CDH1 methylation occurs in high frequencies in ductal breast tumors.
25253721 Data indicate that E-cadherin ubiquitination consistently increases after depletion of kinesin-like protein KIFC3 or ubiquitin-specific protease USP47.
25253020 Btbd7 contributes to reduced expression of E-cadherin and may be a promising cancer marker in non-small cell lung cancer.
25248927 Zonula occludens-1, occludin and E-cadherin expression and organization in salivary glands
25233932 we observed the coordinated loss of E-cadherin (CDH1) and transforming growth factor beta receptor II (TGFBR2) in esophageal squamous tumors.
25216292 Estrogen promotes the invasion of ovarian cancer cells via activation of the PI3K/AKT pathway, downregulation of Ecadherin and upregulation of alphaactinin4.
25197077 PLCdelta1 has tumor-suppressive functions in colorectal cancer through E-cadherin induction.
25174950 Study demonstrated that reactive oxygen species promote the migration and metastatic growth of ovarian cancer cells via upregulation of HIF-1a and LOX and E-cadherin repression.
25164084 E-cadherin may directly regulate gene transcription. [Review]
25161999 Increasing evidence suggested that microRNA mediated E-cadherin expression in the head and neck cancers by directly/indirectly targeting the transcription suppressors of E-cadherin, ZEB1 and ZEB2.
25150394 The rs8049282 SNP of the E-cadherin gene may be a potential molecular marker for the development of primary infertility in northern Chinese women with ovarian endometriosis.
25146682 CCND1 870G/A and CDH1 -160C/A SNPs may contribute to the etiology of colorectal cancer in South Indian population and carriers of the 870A/-160A haplotype have a higher risk for colorectal cancer susceptibility.
25117932 Data demonstrated that Rab11 regulated E-cadherin expression and promoted colon cancer cell transformation.
25093414 Reduced E-cadherin expression indicates a poor prognosis for patients with HCC (hepatocellular carcinoma), and it may have predictive potential for prognosis of HCC patients.[meta-analysis]
25086032 siRNA knockdown of SMAR1 expression in these breast cancer cells results in a coordinative action of Slug-mediated repression of E-cadherin transcription.
25079037 Results showed that E-cadherin loss disrupts the organization of the cell's actin and microtubule cytoskeletons and modifies its adherence and migration characteristics but is insufficient to induce an epithelial to mesenchymal transition.
25064356 our study demonstrated that Nur77 could promote the invasion and metastasis of colorectal cancer cells through regulation of MMP-9/E-cadherin signaling
25056535 the present meta-analysis provides further evidence that promoter methylation and -160C/A polymorphism of E-cadherin gene may confer a risk to prostate cancer
25015036 The loss of membranous E-cadherin with increase in cytoplasmic accumulation in differentiative layers of epithelium through the progression of dysplasia was noted along with up-regulation in VEGF expressions
25010141 CD133 associates with beta-catenin in early placodes, and its continued expression correlates with loss of beta-catenin and E-cadherin from the cell membrane at a time when E-cadherin transcriptional repressors Snail and Slug are not implicated.
25007342 lncRNA-EBIC is an oncogenic lncRNA, which can promote tumor cell invasion in cervical cancer by binding to EZH2 and inhibiting E-cadherin expression.
24999604 Low E-cadherin expression is associated with gastrointestinal stromal tumor metastasis.
24985974 Down-regulation of NDRG1 in gastric cancer metastatic progression was correlated to E-cadherin and MMP-9.
24973953 The methylation of E-cadherin is one of the main reasons for the reduction of E-cadherin expression in ovarian cancer.
24966968 E-cadherin and P120 catenin cocktail immunostain can be used to differentiate ductal carcinoma in situ from lobular carcinoma in situ.
24965120 HIV-1 Tat C treated human brain microvascular endothelial cells result in downregulation and dissociation of VE-PTP and SHP2 from VE-cadherin
24935589 In the present study, with an increasing concentration of metformin, the expression of MMP-9 was downregulated whereas that of E-cadherin was significantly upregulated.
24924873 Declining E-cadherin expression is a possible immunohistochemical predictor of patient prognosis in stage III colorectal cancer.
24915900 Shh signaling may promote invasion and metastasis of oral squamous cell carcinoma by activating MMP-9 and E-cadherin expression.
24906605 Studies indicate that hypermethylation frequencies in lung cancer (LC) tissues were significantly higher than those in normal control tissues
24894673 Data suggest that macrophages contributed to the decreased expression of E-cadherin by NF-kappaB/Slug protein pathway in hepatocellular carcinomas.
24893577 E-cadherin and b-catenin immunostaining showed no prognostic value for basaloid and conventional squamous cell carcinomas
24887090 Downregulation of CDH-1 resulting from the epithelial-to-mesenchymal transition may be closely involved in lymph node metastasis in tongue squamous cell carcinoma.
24882208 E-cadherin augmented DR4/DR5 clustering and assembly of the death-inducing signaling complex, increasing caspase-8 activation in high molecular weight cell fractions.
24878505 The sialylation pattern of alpha2beta1 integrin and E-cadherin.
24870781 Results showed that three polymorphisms of CDH1 were significantly associated with cancer risk, -160 C>A, -347 G>GA and 3'-UTR +54 C>T. [Meta-Analysis]
24867095 Data suggest that E-cadherin can act as a central modulator of tumor cell phenotype and is a potential metastasis marker in cholangiocarcinoma (CCA).
24857367 placental expression significantly increased in preeclampsia compared to normotensive pregnancies
24840851 Loss of CDH1 is associated with promotes hepatocellular carcinogenesis.
24838934 We found a strong association between the cancer predisposing gene CDH1 and the risk of non-syndromic cleft lip with or without cleft palate in the Polish population
24811168 studies identify Cdh1 as an important regulator of nuclear/chromatin PTEN during mitosis.
24807161 Results indicate that loss of E-cadherin expression is a consequence rather than a cause of c-erbB2-induced epithelial-mesenchymal transition.
24795530 The disruption of cell adhesion junction by suppression of E-cadherin mediates gallotannin enhanced apoptosis in Hep G2 liver cancer cells.
24781336 Low E-cadherin protein expression correlate with an aggressive, malignant phenotype in hepatocellular carcinoma.
24750186 The relatively slow progression of disseminated peritoneal adenomucinosis may be attributable to the smaller number of single isolated tumor cells that lack E-cadherin expression
24742175 Lack of E-cadherin has been recorded at an early phase in carcinomas.
24738865 Ntn-1 induces MMP-12-dependent E-cad degradation via the distinct activation of PKCalpha and FAK/Fyn, which is necessary to govern the activation of ERK, JNK, and NF-KB in promoting motility of umbilical cord blood-derived mesenchymal stem cells.
24716948 The expression of E-cadherin in OSCC was significantly lower than the control tissues but galectin-9 expression was conversely higher.
24716905 CD44 v6 and E-cad expressions had a significant correlation in the NSCLC tissue with lymphatic metastasis.
24715175 E-cadherin and MMP-9 expression at histologically negative surgical margins shows the significance of these markers for prognostic values in oral squamous cell carcinoma patients.
24700054 MMP-2, MMP-9, and E-cadherin are expressed in the endometrium of infertile patients during the receptive phase of the natural menstrual cycle. However, there is no correlation between the expression of these molecules and the clinical IVF outcomes.
24699825 In pancreatic adenocarcinoma cells, PAR3 knockdown enhances cell adhesion. We propose this is due to increased expression of E-cadherin, leading to a greater adhesion of free-floating cells to cells bound to the surface via integrins, particularly ITGalphav.
24696260 The expression of PRL-3, but not of E-cadherin, was associated with shorter survival of patients. PRL-3 and E-cadherin exhibit interactions in gastric cancer and are involved in the formation of lymph node metastases.
24684952 CDH1 - 160C --> A promoter polymorphism and haplotypes are associated with diffuse gastric cancer.
24684802 Collectively these data unveil that FBXL19 functions as an antagonist of Rac3 by regulating its stability and regulates the TGFbeta1-induced E-cadherin down-regulation.
24660577 rs13689 of CDH1 gene is correlated with the syndrome differentiation of gastric cancer.
24631688 Here, we report that infection with HCV derived from pJFH-1 replicon system that mimics natural infection elevates protein levels of DNA methyltransferase 1 and 3b to enhance DNMT activity in human hepatocytes.
24623684 Extensive remodeling of the actin cytoskeleton and focal adhesions accompanies cell fusion and differentiation and appears related to alterations in E-cadherin in trophoblastic cells.
24615049 the summarized analyses of these case-control studies demonstrated that the -160A of the epithelial cadherin gene exhibited no significant association with susceptibility for diffuse gastric cancer
24586397 HIV-1 Tat C treated human brain microvascular endothelial cells result in downregulation and dissociation of VE-PTP and SHP2 from VE-cadherin
24571487 Loss of E-cadherin is mediated through inhibition of mTORC1 in lung cancer cells.
24569788 highly sensitive rabbit E-cadherin antibody is the preferred antibody for evaluating ductal carcinomas and for distinguishing ductal versus lobular lesions, and the dual stain was superior to the single E-cadherin stain
24565133 results suggest that E-cadherin loss promotes SNAI1 expression that controls the aggressiveness of prostate cancer cells
24522810 Loss of E-cadherin is associated with breast carcinoma.
24505377 In increased E-cadherin expression.
24499657 WNT/beta-catenin pathway and E-cadherin are important factors in advanced epithelial ovarian cancer.
24491043 Our meta-analysis indicates that promoter polymorphism and methylation of CDH1 gene may be involved in the development and progression of bladder cancer
24488011 In conclusion NSCLC cell lines, positive for E-Cadherin,EpCAM and avb6 expression, activate normal fibroblasts through avbeta6/TGFbeta signalling in vitro, and influence both gene expression and response to therapeutic agents.
24480745 Over-expression of miR-888 reduced the mRNA levels of E-cadherin in MCF-7 side population sphere cells.
24470282 Low CDH1 expression is associated with laryngeal squamous cell carcinoma.
24464006 GSTP1 and E-cad did not show any relevant methylation pattern in various endometrial lesions.
24455846 In high grade malignant tumors (G1), CDH1 and ITGB1 gene expression was the highest, in G2 and G3 tumors the expression of both genes was gradually lowering
24452374 AKAP proteins, most likely AKAP9, maintain the bronchial epithelial barrier by regulating the E-cadherin expression at the cell membrane.
24424621 MTA1 promotes tumor invasion by downregulation of E-cadherin
24418088 Studied the expression of E-cadherin, N-cadherin, TGF-beta1 and Twist protein and investigate its significance in the occurrence and development of prostate cancer.
24404589 E-cadherin gene promoter hypermethylation may contribute to increased risk of bladder cancer among Asian populations.
24389957 Two novel CDH1 mutations were found. The c.602_603delCT mutation results in a frame-shift and a premature stop at codon 207, and is classified as pathogenic. The functional consequence of the c.1565 + 3insTT mutation was unknown and not as obvious.
24388773 A potential important role of alpha4 in control of cell migration and/or invasion via the regulation of E-cadherin expression in bladder urothelial carcinoma.
24374173 Deletion of beta-catenin by siRNA abrogated celecoxib-induced inhibition of MMP9 up-regulation and E-cadherin down-regulation by treatment of PGE2 in A549 cell.
24366306 We have shown that germline CDH1 mutations are associated with early onset of bilateral lobular carcinoma in situ with or without Invasive lobular breast cancer in women without a family history of gastric cancer.
24356446 APC-Cdh1 establishes a stimulus-response relationship that promotes S phase.
24347544 show that BMP acts prior to and independently of Cdh1 to prime pluripotent cells for mesoderm differentiation, thus helping to reinforce the block to neural differentiation
24341230 A more complete study of the prognostic and predictive role of E-cadherin expression in patients with Stage I-II NSCLC will help identify a prognostically unfavorable group of patients who may be given additional treatment in the postoperative period.
24325792 E-cadherin expression was down-regulated in gastric cancer.
24304617 Positive ZEB-1 expression and loss of E-cadherin expression are correlated with poor prognosis in hepatocellular carcinoma patients.
24293545 Low expression of E-cadherin is associated with gastric carcinomas.
24292671 Inhibition of SALL1 correlates with reduced levels of CDH1, an important contributor to epithelial-to-mesenchymal transition.
24286617 E-cadherin protein expression in the cecum was lower in IBS-A compared with controls and associated with longstanding symptoms. E-cadherin was further associated with abdominal pain severity in the IBS group overall, but unrelated to IBS subtype.
24274398 Low E-Cadherin expression is a negative prognostic factor of oral squamous cell carcinoma and is likely due to the hypermethylation of CDH1 promoter.
24273956 E-cadherin expression was the same in the cholesteatoma matrix in all samples. There were no differences in expression according to the clinical and histological characteristics of the cholesteatomas.
24272200 decorin-mediated inhibition of cholangiocarcinoma cell growth, migration,and invasion and promotion of cell apoptosis might be through regulation of the expression of E-cadherin in vitro.
24268141 cancer-related mutations in beta-catenin can influence tumor progression by weakening the adhesion of tumor cells to one another through reduced individual Ecad/Ecad bond strength
24222154 Low E-Cadherin expression is associated with endometrial cancer.
24222146 Reduced E-Cadherin expression is associated with nodal metastasis in T1 esophageal squamous cell carcinoma
24211838 Loss of CDH1 induces EGFR expression via phospho-YBX1, which is activated through the AKT signaling pathway.
24204729 Data suggest that E-cadherin (CDH1) screening, in addition to the identification of other risk factors, could be useful for the early detection of gastric cancer (GC) in subjects at risk.
24197976 Our findings suggest that abnormal expression of beta-catenin and E-cadherin occurred frequently in gastric carcinoma and correlated with worse clinical behaviour.
24175817 High E-cadherin expression was associated with increase in degree of differentiation, and decrease in lymph node involvement in laryngeal squamous cell carcinomas.
24163370 NEDL2 is a novel substrate of APC/C-Cdh1 as cells exit mitosis and functions as a regulator of the metaphase to anaphase transition
24127122 Analysis of gene expression datasets confirmed the association between low PIP4K2B and low CDH1expression.
24124614 Mammosphere formation in breast carcinoma cell lines depends upon expression of E-cadherin.
24120284 filamin A generates a scaffold for organizing a signaling complex that promotes E-cadherin-mediated cell-cell adhesion and keratinocyte differentiation
24115825 COX-2 likely functions upstream of NF-kappaB and regulates the expression of E-cadherin via NF-kappaB/Snail signaling pathway in gastric cancer cells.
24100295 MAD2L2 helps to ensure a robustly bistable switch between APC/C(CDC20) and APC/C(CDH1) during the metaphase-to-anaphase transition, thereby contributing to mitotic fidelity.
24084461 Poor prognosis for serous ovarian cancer patients with CD44(+)/E-cadherin(-) and CD44(+)/budding(+) tumor cells phenotype, has been revealed
24081672 Gli-1 expression increased markedly, and was closely associated with increased Snail expression and decreased E-cadherin
24075276 Epithelial-to-mesenchymal transition status is determined by calculating the ratio of vimentin to E-cadherin, whereby patients are categorized into 3 groups: epithelial, intermediate, and mesenchymal.
24068440 No associations were noted between promoter hypermethylation of the CDH1 gene and biological features of the endometrial cancer cases.
24063632 PP6c associates with E-cadherin in adherens junctions and is required to oppose casein kinase-1 to maintain cell surface localization of E-cadherin.
24054361 Susceptible CDH1 genotypes might modulate the development of asthma, especially for children exposed to environmental tobacco smoke.
24046456 The knockdown of flotillins dramatically affected N- and E-cadherin recruitment at CCJs in mesenchymal and epithelial cell types and perturbed CCJ integrity and functionality
24045896 A novel role for ILK in glioma invasion and metastasis processes via downregulation of CDH1.
24045095 CDH1 hypermethylation is associated with triple-negative breast cancers.
24035280 These results indicated a possible effect of SIRT1 and p300/CBP involved in regulating the expression of E-cadherin and MLH1, thus participating in the tumor progression of gastroesophageal junction cancer
24023817 the CDH1 polymorphism is involved in the etiology of nephrolithiasis
24023670 BCL2 is not involved in lobular breast carcinogenesis and is unlikely to represent an important determinant of tumor development driven by CDH1 inactivation.
24023308 current study showed that the majority of DGC cases demonstrated concurrent CDH1 promoter methylation in tumor tissues and in non-neoplastic mucosa
24022108 Hypermethylation of E-cadherin is associated with gastric cancer.
24012693 Low level of E-cadherin expression is associated with breast cancer.
24003087 TGF-beta2 activated Smad-2/3, serine-threonine kinase (AKT), and extracellular signal-regulated kinase (ERK) signaling, and enhanced expression of beta-catenin as well as N- and OB-cadherin.
23996289 Our study demonstrates significantly elevated serum levels of sE-cadherin in women with systemic lupus erythematosus compared with healthy women.
23991044 Data indicate that E-cadherin was elevated , and the expression levels of N-cadherin, Vimentin and Twist1 were all decreased in oleanolic acid (OA)-treated cells.
23990016 Expression of E-cadherin is significantly associated with tumor location and mortality in patients with oral squamous cell carcinoma.
23958301 E-cadherin expression in squamous cells is reduced by HD-5
23954296 SALL4 functions to suppress CDH1 expression and to maintain cell dispersion in basal-like breast cancer.
23954158 FadA binds to E-cadherin, activates beta-catenin signaling, and differentially regulates the inflammatory and oncogenic responses.
23945386 Suppression of CDH1 transcription is associated with the development and progression of non-small-cell lung cancer.
23936352 expression and subcellular localization of p120-catenin and beta-catenin in oral carcinomas
23929433 miR-23a inhibits E-cadherin expression in gastrointestinal cancer.
23900729 Positive correlations between the expression of E-cadherin and NDRG2 were shown in several colon cancer cell lines as well as in colon cancer tissues.
23900215 CDH-1 expression exhibited a negative correlation with the invasiveness of colon cancer cells.
23890107 GLI2 represses E-cadherin gene (CDH1) expression in melanoma cells via distinct mechanisms, enhancing transcription of the EMT-activator ZEB1.
23890049 We suggest that the down-regulation of E-cadherin in multicentric/multifocal breast cancer is causally connected with the worse prognosis of this tumor type.
23888941 There was a significantly positive correlation between miR-200a and E-cadherin in epithelial ovarian cancer
23873106 Data show that miR-148a downregulated vimentin expression and upregulated E-cadherin expression, suggesting that miR-148a inhibited epithelial-mesenchymal transition (EMT), and the SMAD2 gene was identified as the direct and functional target of miR-148a.
23866665 methylation of E-cadherin promoter is associated with risk of lung cancer
23856093 Western blotting and real-time reverse transcriptase-polymerase chain reaction demonstrated that these cells had downregulated E-cadherin protein and messenger RNA levels, respectively
23850675 celastrol treatment restored E-cadherin promoter activity in TGF-beta1-treated cells
23840677 Loss of E-cadherin and beta-catenin with cytoplasmic ALCAM accumulation may play pivotal role in oral cancer development and progression.
23837653 The expression of E-cadherin and beta-catenin, combined with cytological and architectural analysis, may highlight different immunophenotypes and improve classification of breast carcinomas in situ with mixed pattern.
23826417 The abnormal expression of E-cadherin and beta-catenin proteins might be useful in distinguishing vulvar intraepithelial neoplasia from non-neoplastic vulvar squamous epithelium lesions in problematic cases.
23813140 The increased therapeutic efficacy of the PEG-IFNalpha2b plus RBV treatment could be secondary to the inhibition of claudin-1 and E-cadherin cell membrane expression.
23792261 The soluble serum E-cadherin levels in breast cancer patients undergoing preoperative systemic chemotherapy have high predictive value.
23788111 High expression of GLI1 dampened expression of E-cadherin and enhanced the expression of Vimentin.
23787212 Data suggest that, in tubal pregnancy, fallopian tube mucosa exhibits reduced E-cadherin expression, enhanced beta-catenin expression, and glycogen accumulation; tubal arteries exhibit neovascularization and hyperplasia in tubal pregnancy.
23776059 this study shows that sEcad is a novel candidate protein for drug targeting since it is increased in human and mouse HER2-positive (HER2+) breast tumors, MMTV-PyMT bodily fluids and human cell culture systems.
23775192 APC/C(Cdc20), and APC/C(Cdh1) act successively to ensure that the disappearance of licensing inhibitors coincides exactly with a peak of Cdt1 and Cdc6.
23771665 Combined detection of VM, HIF-lalpha and E-cad plays an important role in predicting the invasion, metastasis and prognosis of patients with ESCC.
23771069 These findings support the potential value of E-cadherin for a supplementary differentiation of molecular subtypes of breast carcinoma, based on the biological significance of its capacity of expression.
23743934 Suggest that ZEB1 overexpression, associated with E-cadherin and miR-200s downregulation, and the expression of mesenchymal markers might enhance the metastatic potential of undifferentiated endometrial carcinomas.
23732279 ELE increased both the protein and mRNA levels of E-cadherin.
23724143 activation of AKT plays a role in contactin-1-mediated downregulation of E-cadherin.
23719484 E-cadherin expressing mononuclear histiocytes are likely precursors for multinucleated giant cells in cutaneous granulomas and may play a critical role in disease pathogenesis.
23709761 CDH1 germline mutations and the hereditary diffuse gastric and lobular breast cancer syndrome
23696789 APC(CDH1) targets MgcRacGAP for destruction in the late M phase.
23677639 Data indicate that pancreatic (pro)enzymes enhanced expression of beta-catenin and E-cadherin and decreased expression of several epithelial-mesenchymal transition (EMT)-associated genes, such as Vimentin, Snail and Slug.
23671930 GnT-III determines E-cadherin-mediated tumor suppression, and GnT-V regulates E-cadherin-mediated tumor invasion.
23660954 The present study examined the expression of AP-2alpha, TIMP-2, MMP-2, MMP-9, and E-cadherin in severe preeclamptic placentas and normal placentas.
23645745 High E-cadherin expression is associated with lymphatic vessel invasion in abdominal metastases of breast cancer.
23643811 phosphorylation on CRY-box by Polo-like kinase-1 is required for Cdh1-dependent degradation of Cdc20 during somatic cell cycle
23639974 We showed that cadherin and nectin in the junctions of A431 cells and human keratinocytes are located in separate clusters.
23637229 Data indicate that regulation of Rad17 turnover is through the Cdh1/anaphase-promoting complex pathway in breast cancer cells.
23621216 The expression of Twist is upregulated, whereas that of E-cadherin is downregulated in ovarian cancer.
23621211 Cx43 and E-cadherin are reduced with non-small cell lung cancer progression, and might be important biomarkers for judging the metastasis and prognosis.
23620408 Our results establish that the E-cadherin ectodomain-specific mAb DECMA-1 inhibits Ecad(+)/HER2(+) breast cancers by hindering tumor growth and inducing apoptosis via downregulation of key oncogenic pathways
23605324 results suggest that reduced expression of E-cadherin is associated with promoter methylation of E-cadherin gene, in addition to providing evidence for the aberrant nuclear localization of E-cadherin in epithelial ovarian carcinoma
23579873 Loss of E-cadherin expression is associated with poor response to epidermal growth factor receptor-tyrosine kinase inhibitor treatment in lung cancer.
23575477 Data indicate that genomic profiling of relapsed CDH1-mutated invasive lobular carcinoma (ILC) featured a high incidence of ERBB2 alterations.
23551055 The CDH1 -160C/A polymorphism may constitute an inheritable risk factor for breast cancer in south Indian women.
23546450 miRNA-200c inhibited Akt signaling through its effects on E-cadherin and PTEN, resulting in the inhibition of doxorubicin resistance in breast cancer cells.
23542467 HER2 is implicated in mediating the effects of epidermal growth factor (EGF) on Snail, Slug and E-cadherin expression as well as inducing invasiveness of ovarian cancer cells.
23530113 Data indicate that patients with basal subtype breast cancer and high E-Cadherin expression in their tumors had a poor clinical outcome.
23524144 O-GlcNAcylation could enhance ovarian cancer cell migration and reduce the expression of E-cadherin and the formation of the E-cadherin/catenin complex, thereby reducing intercellular adhesion.
23504025 Data show that TGF-beta1 regulates E-cadherin and vimentin expression through KLF8 pathway.
23483729 The overexpression of EBP50 could inhibit the growth of hepatocellular carcinoma cells and promote apoptosis by modulating beta-catenin, E-cadherin.
23481203 Cadherin alterations are associated with inherited human diseases.
23481202 E-cadherin alterations are associated with hereditary diffuse gastric cancer.
23469016 show that the Gas2l3 protein is targeted for ubiquitin-mediated proteolysis by the APC/C(Cdh1) complex, but not by the APC/C(Cdc20) complex, and is phosphorylated by Cdk1 in mitosis
23464474 A high membrane/cytoplasm (M/C) ratio of E-cadherin expression.
23455756 Aberrant expression of E-cadherin and integrin beta-1 is closely related to malignant transformation and hydatidiform mole development.
23443028 Studies suggest CDH1 mutation for the diagnosis of Hereditary diffuse gastric cancer.
23437163 Down-regulated LIV-1 cells showed significant inhibition of proliferation in vitro and reduction of tumor growth in vivo. Furthermore, E-cadherin expression increased in LIV-1 siRNA expressing Hep-G2.
23435907 E-cadherin 1054del83 transcript is a frequent event in gastric cancer.
23435375 BRAF(V600E) increases migration and invasion of thyroid cancer cells via upregulation of Snail with a concomitant decrease of its target E-cadherin.
23431106 Report novel CDH1 germline mutations in Chinese sporadic gastric cancer patients.
23430339 alterations of their expression suggest a role of Dsg3 and gamma-catenin (additionally to E-cadherin/beta-catenin) as biomarkers of malignant transformation risk of oral dysplasia and the biological behavior (aggressiveness) of oral cancer, respectively
23423910 Overexpression of delta-catenin reduces the expression of E-cadherin and alters the balance between E-cadherin and p120ctn, which in turn affects the formation of intercellular adhesions and promotes invasion and metastasis in colorectal cancer.
23410973 Loss of E-cadherin is associated with ovarian cancer.
23386606 the CD91/IKK/NF-kappaB signaling cascade is involved in secreted HSP90alpha-induced TCF12 expression, leading to E-cadherin down-regulation and enhanced CRC cell migration/invasion
23381389 We found upregulated miR-200a expression to increase E-cadherin and suppress the Wnt/beta-catenin pathway by targeting ZEB1 and ZEB2 in GA, thus delaying tumor growth in vivo.
23376074 these results suggest that E-cadherin expression in cancer cells is controlled by a balance between ZEB2 and KLF4 expression levels.
23375645 The aberrant high expression of beta-catenin and decreased expression of E-cadherin is associated with poor prognosis in nasopharyngeal carcinoma.
23371049 Data indicate that TIMP-2 promotes an anti-tumoral transcriptional profile in lung cancer including upregulation of E-cadherin.
23364919 Human c-Myc represses E-cadherin at the post-transcriptional level through miR-9.
23355201 Loss of E-cadherin and aberrant beta-catenin expression could be a prognostic factor in patients with small intestinal adeno-carcinomas.
23354591 E-cadherin expression is downregulated and is negatively correlated to Long non-coding RNA H19 expression in bladder cancer
23349470 In oral squamous cell carcinoma the probability to have or develop metastases was very low when high E-cadherin expression was found in a preoperative sample or when a low podoplanin expression was found
23349466 The expression of E-cadherin and beta-catenin in pituitary adenoma was significantly downregulated and related to subtype, invasiveness, and postoperative recurrence.
23347178 E-cadherin is not a tumour suppressor gene in invasive ductal carcinoma of the breast.
23341533 study found CDH1 somatic alterations exist in all clinical settings and histotypes of gastric cancer and associate with different survival rates
23339695 Increased expression of CD10 in transitional and squamous cell carcinoma (TCC/SCC) tumor and stromal cells, and decreased expression of E-cadherin in TCC tumor cells, are correlated with tumor progression, invasion, and metastasis in human bladder cancer.
23338761 these results indicate that in human breast cancer loss of E-cadherin is not causal for EMT and even not a necessity.
23322209 the majority of cervical cancers in the study were E-cadherin positive; no correlation was found between the level of E-cadherin expression and the oxygenation status
23318419 sEcad contributes to skin carcinogenesis via association with the HER/IGF-1R-family of receptors and subsequent activation of the MAPK and PI3K/Akt/mTOR pathways.
23317244 Loss of E-cadherin is associated with serous ovarian cancer.
23314859 LSD1 expression was higher, while E-cadherin expression was lower, in colon cancer specimens of high TNM stage and with distant metastasis. Positive LSD1 expression and negative E-cadherin expression were correlated with lower overall survival.
23298185 WT1 binds to the E-cadherin promoter and regulates gene expression in prostate cancer.
23292832 soft tissue leiomyosarcoma patients with the gain of E-cadherin and loss of Vimentin expression represent favorable trend of survival
23269354 Negative E-cadherin expression seems to predict unfavourable clinical outcome in patients with advanced-stage serous ovarian cancer
23266572 The capacity of TFF1 to enhance prostate cancer cell migration/invasion is mediated by transcriptional repression of E-CADHERIN.
23264214 The variants of differentiated cancers with a poorer prognosis (i.e. tall cell and follicular variants of papillary cancer and widely invasive follicular cancers) present reduced intensity of E-CAD expression.
23264079 E-cadherin gene mutations are associated with gastric cancer.
23261982 Dkk-1 inhibited the survival and migration of human PTC cells by regulating Wnt/beta-catenin signaling and E-cadherin expression.
23261830 C. albicans significantly decreased E-cadherin mRNA expression & protein production in gingival epithelial cells. IFN-gamma prevented this effect.
23261431 Snail regulates levels of E-cadherin and desmoglein 2 in oral squamous cell carcinoma cells both transcriptionally and post-translationally.
23254865 Loss of E-cadherin may be mediated through NF-kappaB-induced Snail upregulation.
23250779 Data confirm that E-cadherin and COX-2 expressions are related to OSF. The epigenetic changes presented in patients with chronic inflammation might demonstrate an irreversible destruction in the tissues or organs similar to the effects of cancer.
23244126 Decreased levels of E-cadherin is associated with lung cancer.
23240619 Expression of E-cadherin is not associated with malignant progression of brainstem gliomas, unlike beta-catenin and neuronal cadherin.
23225423 E-cadherin and alpha-catenin down-regulation might be associated with neoplastic transformation in laryngeal tissues and might be regarded as a risk factor for clinical recurrence.
23221510 The data showed that both fascin and vimentin proteins were significantly overexpressed in cholangiocarcinoma, whereas E-cadherin expression was reduced in cholangiocarcinoma compared with normal tissues.
23220849 Report immunohistochemical CDH1 expression in hyperplastic and neoplastic lesions of the prostate gland.
23214316 The high expression of Ezrin and the low expression of E-Cadherin were related to invasion and metastasis in papillary thyroid carcinoma.
23197654 CDH1 missense mutations were found in 4 out of 81 (5%) patients with non-syndromic OFC. This finding opens a new pathway to reveal the molecular basis of non-syndromic OFC. Cancer risk among carriers of these mutations needs to be defined.
23190890 Oncogenic B-RAF(V600E) signaling induces the T-Box3 transcriptional repressor to repress E-cadherin and enhance melanoma cell invasion.
23189137 the E-cadherin promoter is repressed in cells expressing E6, resulting in fewer E-cadherin transcripts.
23180380 Results show a role for E- and P-cadherin co-expression in breast cancer progression and highlight the potential benefit of targeting P-cadherin in the aggressive tumours expressing high levels of this protein.
23169395 Downregulation of E-cadherin was associated with gastric cancer.
23135957 intermolecular interactions are required for Langerhans cell differentiation in the epidermis
23122825 Elevated plasma soluble E-cadherin expression was involved in the pathogenesis of PID and is useful for the diagnosis of PID.
23102249 The low expression of CD82/KAI1 and E-cadherin was closely related to the invasion, progression and metastasis of non-small cell lung cancer.
23093058 After exposure to hypoxia, HIF-1alpha protein was up-regulated, both mRNA and protein levels of E-cadherin were down-regulated and MMP-2 was up-regulated, while HIF-1alpha mRNA showed no significant change
23086683 Overexpression of NEDD9 correlated with abnormal expression of E-cadherin, beta-catenin and N-cadherin.
23073328 Mapping of cancer foci showed the highest density in the anterior proximal fundus (37%) and cardia/proximal fundus (27%).
23070965 Interaction between alpha6 integrin and E-cadherin drives liver metastasis of colorectal cancer cells through hepatic angiopoietin-like 6.
23067217 Enhanced expression of E-cadherin is associated with the development of cervical neoplasia and cancer.
23065281 Key roles of ZEB1 and E-cadherin in the oncogenesis and invasiveness of lung squamous cell carcinoma.
23054081 E-cadherin, EMMPRIN and MMP-8 median values were significantly increased in all chronic kidney disease children, as well as in all dialyzed patients versus controls
23053649 E-cadherin promotor methylation and mutation are inversely related to motility capacity of breast cancer cells.
23049725 Loss of SARI expression initiates epithelial-to-mesenchymal transition (EMT), which is visualized by repression of E-cadherin and up-regulation of vimentin in lung adenocarcinoma cell lines and in clinical lung adenocarcinoma specimens.
23047512 The drug-resistant MCF-7/Adr cells were found to be more invasive/metastatic than their parental control, possibly related to the loss of E-cadherin expression.
23042269 The aim of this study is to evaluate the role of p130cas, E-cadherin, and beta-catenin expression in patients with non-small cell lung cancer.
23029563 SNAI1 expression was significantly correlated with lower expression of CDH1 in colorectal adenoma.
23029385 The overexpression of SLUG and TWIST with down-regulation of E-cadherin was characteristic findings in hemangiopericytomas and solitary fibrous tumors, but not in meningiomas.
23016467 E-cadherin expression in nevi is related to the degree of melanocytic maturation.
23007606 the loss of CDH1/E2F4 may be associated with worse clinical and pathological findings in mammary ductal carcinoma.
23002209 Studies indicate that E-cadherin and versican are involved in cancer epithelial-mesenchymal transitions and metastasis.
23001948 E-cadherin expression correlated negatively with PMN infiltration, compatible with the notion that E-cadherin is cleaved by PMN-derived elastase
22967445 Ezrin, E-cadherin and CD44V6 play an important role in the regulation of growth and meastasis of lung cancer.
22949882 Low cadherin 1 expression is associated with hepatocellular carcinoma invasion.
22945654 Nanog-mediated cell migration and invasion involved its regulation of E-cadherin and FOXJ1.
22942707 CDH1 methylation-positive cervical cancer patients had a 7.8-fold risk for death and a 92.8-fold risk for relapse.
22941158 CDH1 mutation is associated with gastric and breast cancer.
22939576 E-cadherin may serve as an additional diagnostic marker for angiomyolipoma.
22933707 Recruitment of histone deacetylases by transcriptional repressors LEF-1 and Slug is responsible for E-cadherin suppression and epithelial-to-mesenchymal transition in cigarette smokers.
22912891 Data indicate that cultured tubular cells (hPTECs) reorganized into patches of cells with homotypic N-cadherin or E-cadherin cell-cell adhesions.
22903530 changes in the expression of Snail or E-cadherin might regulate Epithelial-mesenchymal transition development in cholangiocarcinoma
22903481 There is an association between decreased E-Cadherin immunoexpression and tumor recurrence in low-grade and non-muscle invasive transitional cell carcinoma of the bladder.
22901162 Reduced expression of E-cadherin is associated with ovarian cancer.
22886823 High Slug and low E-cadherin expression in basal-like breast cancer (BLBC) correlated with histological grade, TNM stage, and lymphatic metastasis. Poor prognosis of BLBC is associated high Slug and vimentin expression and low E-cadherin levels.
22868917 Loss of E-cadherin is associated with hepatocellular carcinoma.
22850631 E-cadherin cytoplasmic mutations interfere with the binding of key exocytosis-related partners
22847601 Our results suggest that Twist was expressed significantly more and E-cadherin significantly less in osteosarcoma with metastasis
22847191 These findings indicate the existence of a novel E-cadherin-related mechanism by which miR-10b modulates breast cancer metastasis.
22846972 We conclude that determination of E-cadherin expression can be used as an adjunct in selecting patients who may benefit from adjuvant chemotherapy in the presence of otherwise favorable prognostic factors.
22827846 In the -197 A allele carrier with *1249 CC homozygote of IL17A, the methylation of DAPK and CDH1 increased gradually, but more rapidly, with age.
22820858 invasiveness was significantly correlated to the loss of membranous E-cadherin, as well as to increased ASMA, S100A4, and PDGFRbeta in stromal cells.
22820000 we have demonstrated an association of epithelial E-cadherin expression with stromal histologic features and disease recurrence in phyllodes tumor.
22799630 impact of cell-cell contact, E-cadherin and EGF receptor on the cellular radiosensitivity
22799366 These results provide strong evidence that the methylation status of E-cadherin gene contributes to a reduction in the expression of E-cadherin mRNA, and may play a role in the development and progression of non-small cell lung cancer.
22792244 A meta-analysis indicated that the -160A allele of E-cadherin provides a higher risk for the development of prostate and urothelial cancers and a protective role for colorectal cancer in an ethnicity-dependent manner.
22780949 These findings establish a principal biological function of SIRT1 in the modulation of E-cadherin function.
22774602 The expressions of E-cd and alpha-cat are significantly lower in prostate cancer than in benign prostatic hyperplasia, and they are not associated with cancerous metastasis, but negatively correlated with the PSA level in PCa patients.
22767590 high intracellular PKCK2 activity confers anoikis resistance on esophageal cancer cells by inducing E- to N-cadherin switching.
22752307 Transcription initiation arising from CDH1 intron 2 encoded a nove lCDH1a that increases gastric cancer cell invasion and angiogenesis.
22752005 findings suggest that miR-23a regulates TGF-beta-induced epithelial-mesenchymal transition by targeting E-cadherin in lung cancer cells
22733455 findings show that alpha-catulin is highly expressed in melanoma cells; expression of alpha-catulin promoted melanoma progression and occurred concomitantly with the downregulation of E-cadherin and the upregulation of expression of mesenchymal genes
22729914 Decreased E-cadherin expression was associated with poor survival in patients with non-small cell lung cancer, especially among Asians. [Meta-analysis]
22723466 Approximately 38% of HDGC families have a CDHI gene mutation.
22717556 The aim of the present paper was to evaluate Wwox and TAZ, nuclear effectors of Hippo-related pathways, were involved in E-cadherin expression in bone metastases specimens from breast cancer.
22715382 these results demonstrate a Fyn kinase-dependent mechanism through which IFNgamma regulates E-cadherin stability and suggest a novel mechanism of disruption of epithelial cell contact, which could contribute to perturbed epithelial barrier function.
22704062 Trends in the expression of E-cadherin suggests its involvement in oral carcinogenesis via Wnt pathway dysregulation.
22692503 Investigated the expression of RKIP and E-cadherin in lung squamous cell carcinoma tissue. The rates of positive RKIP and E-cadherin mRNA expression were significantly lower in lung squamous cell carcinoma than in the surrounding normal tissues.
22685614 Data show that Acinetobacter baumannii transposase Tnp in A549 cells induced DNA methylation of CpG regions in the promoters of E-cadherin (CDH1) gene, whereas the cytoplasmic localization of the truncated Tnp without NLSs did not induce DNA methylation.
22658605 Downregulation of E-cadherin may be valuable as risk marker for development of multiple tumours in oral cavity and for diagnosis of premalignant fields.
22648416 Specifically, NiCl(2) induces down-regulation of E-cadherin by reactive oxygen species generation and promoter hypermethylation
22638108 Data indicate that Rab7 siRNA knockdown causes increased E-cadherin.
22634315 these findings identified epigenetic silencing of CDH1 in cancer cells might be a new molecular event of multidrug resistance.
22615871 The M4 mutant, which contains N-terminal 1-54 amino acids and the Armadillo repeat domain, was functional in regulating E-cadherin.
22615104 E-cadherin stimulates the synthesis of intervertebral disc matrix macromolecules aggrecan and collagen II through the induction of BMP genes and enhancement of the Smad1/5 phosphorylation.
22580607 This calpain-mediated proteolysis of E-cad generates the formation of the lymphovascular embolus and is responsible for its unique properties of increased homotypic adhesion, apoptosis resistance and budding.
22580462 The effect of Cdh1 on E2F1 degradation is blocked upon DNA damage.
22580460 APC/CCdh1 is able to ubiquitylate E2F3A in vitro, and that the degradation of E2F3A is stimulated by Cdh1, but not by Cdc20.
22576709 Twist was expressed significantly more and E-cadherin significantly less in gastrointestinal stromal tumors (GISTs) with metastasis, and expression of both was closely related to metastasis of GISTs.
22573479 Rho-GTPase-dependent modulation of cytoskeletal function and downregulation of E-cadherin expression are identified as relevant effectors of the miR-10b-syndecan-1 axis
22571452 alpha- and beta-catenins may be important in the early stages of phyllodes tumours development, while E-cadherin may be required for malignant development
22563106 Histone deacetylase inhibition induced the E-cadherin expression and the proper membrane localization of the E-cadherin/beta-catenin complex, leading to reduced cancer cell migration and invasion.
22562246 Snail interacted with Suv39H1 and recruited it to the E-cadherin promoter for transcriptional repression.
22552350 preoperative serum E-cadherin concentrations are higher in patients with less differentiated prostate cancer
22549778 E-cadherin is critical for collective sheet migration and is regulated by the chemokine CXCL12 protein during restitution
22544614 The expression changes of TGF-beta1 and E-cadherin may be related to the emergence and the development of glioma.
22543706 Growth and proliferation of SKOV-3 cells was efficiently suppressed after knocking-down of E-cadherin expression.
22535324 our results indicated that plasma CDH1 levels may serve as a risk marker against gastric cancer and variant genotypes of rs26160 and rs17690554 may contribute to the etiology of diffuse gastric cancer in this study.
22528227 Our findings suggested that the regulatory function of 4HPR on infiltration of bladder cancer cells T24 is at least partly achieved by regulating the expression of E-Cad.
22525043 E-cadherin was significantly associated with histological grade and alcohol consumption, and beta-catenin was significantly associated with nodal stage, TNM stage, and E-cadherin expression.
22514028 CDH1 methylation was found in 75 of 92 (81.5%) gastric cancer tissues, which significantly correlated with size, growth pattern, differentiation, lymphatic invasion, venous invasion, invasion depth, lymph node metastasis, distant metastasis
22513089 Activation of E-cadherin induces p120-catenin dephosphorylation, as well as changes in the cadherin cytoplasmic domain.
22502664 E-cadherin promoter hypermethylation and intake of local hot salted tea and sun-dried foods are associated with gastric tumors.
22490896 Although the expressions of E-cadherin and N-cadherin appear to be correlated with survival outcomes in bladder cancer, N-E cadherin switch may be a better predicator for postoperative recurrence and cancer-related survival.
22490800 Slug is expressed markedly higher while E-cadherin markedly lower in metastatic gastrointestinal stromal tumors.
22490692 The down-regulation of E-cadherin, as modulated by the methylation of CDH1, may contribute to nerve invasion, lymphatic and distant metastasis in salivary adenoid cystic carcinoma.
22471493 High E-cadherin is associated with invasion and metastasis of gastric cancer.
22470475 E-cadherin structural models suitable to predict the impact of the majority of cancer-associated missense mutations
22450781 Deletions and/or microdeletions at both miR-101 genomic loci cause mature miR-101 down-regulation, subsequent EZH2 over-expression and E-cadherin dysfunction, specifically in intestinal-type gastric carcinoma.
22438585 by promoting EGFR internalization, reggie-1 restricts EGFR signaling involved in E-cadherin macropinocytosis and recycling and regulate adherens junction formation
22434855 E-cadherin gene polymorphism rs4783689 was marginally associated with endometriosis in the Japanese population
22429811 Data suggest that pulmonary metastasis is corrected with levels of Geminin, cleaved caspase-3, CD44, E-cadherin, epidermal growth factor receptor, and CD204 in cancer cells within permeated lymphatic vessels.
22426463 APC/C(Cdc20) or APC/C(Cdh1) complexes regulate RAP80 stability during mitosis to the G(1) phase, and these events are critical for a novel function of RAP80 in mitotic progression.
22421353 Data indicate that up-regulation of Slug was significantly correlated with a higher tumor stage and the E- to N-cadherin switch in bladder cancer cells and tissues.
22411584 Results show that the adipocytokines and glucocorticoid metabolism-related genes are overexpressed in colorectal adenocarcinomas, and expression of these genes is associated with the downregulation of E-cadherin mRNA.
22408413 E-cadherin expression was present in 100% of cases of both adenocarcinomas and adenomas, with prevailing strong membranous immunoreactivity and no differences between protein expression in tumors and normal mucosa.
22406531 Snail interacted with G9a and recruited G9a and DNA methyltransferases to the E-cadherin promoter for DNA methylation.
22375065 The modifications of E-cadherin by O-GlcNAcylation and lack of pro-region processing represent novel mechanisms for rapid regulation of cell surface transport of E-cadherin in response to intoxication.
22339265 the association between CDH1 -C160A genetic polymorphism and colorectal cancer susceptibility
22331730 TWIST may act upstream of E-cadherin, which can indirectly regulate the expression levels of beta-catenin in bladder cancer.
22331587 Our results suggest that endogenous PAI-1 suppresses expression of E-cadherin and differentiation in PAC cells in vitro, supporting its negative impact on tumor prognosis.
22330421 CDH1 polymorphisms can contribute to the etiology of premalignant skin lesions in people chronically exposed to arsenic in drinking water, and that this gene may be a factor in individual susceptibility to cutaneous diseases.
22311018 E-cadherin can act as a central modulator of the cell biological phenotypes and a potential prognostic marker in Colorectal cancer.
22307379 Both membranous and cytoplasmic localization of high E-cadherin staining were associated with lymph node metastasis in nasopharyngeal carcinoma
22302998 E-cadherin inhibits nuclear accumulation of Nrf2 and Nrf2-mediated gene transcription by its interaction with Nrf2; findings imply that chemoresistance of cancer cells upon the loss of E-cadherin might be associated with Nrf2
22300273 Loss of E-cadherin is associated with liposarcoma.
22297548 Associations between RASSF1A and CDH1 methylation levels and clinico-pathological parameters manifested various levels of RASSF1A and CDH1 promoter methylation.
22281980 The reduced expression of E-cadherin and beta-catenin and EGFR over expression seems to be correlated with tumor differentiation and tumor progression than tumor invasion and tumor proliferation.
22278155 Data suggest that TGF-beta, TGF-betaR1, TGF-betaR2, Smad4, pSmad2/3, and E-cadherin are closely related to tumor-node-metastasis (TNM) stage of colorectal cancer (CRC).
22252131 Hakai dimerization allows the formation of a phosphotyrosine-binding pocket that recognizes specific phosphorylated tyrosines and flanking acidic amino acids of Src substrates, such as E-cadherin, cortactin and DOK1.
22237715 Negative/low HER2 expression alone or combined with E-cadherin positivity is predictive of better prognosis in Tunisian patients with breast carcinoma.
22225527 E-cadherin genetic screenings performed in low-risk areas for gastric cancer identified a higher frequency of CDH1 germline mutations.
22221700 The combination of a decrease of E-cadherin and an increase in vimentin might be a valuable survival indictor in cervical squamous cell cancer.
22213313 CDH1 promoter methylation is associated with triple-negative breast cancer.
22209340 Compared with conventional carcinomas, serrated adenocarcinomas showed significantly reduced membranous E-cadherin.
22207358 Epigenetic regulation is a mechanism through which tumor cell colonization of metastatic sites occurs as E-cadherin-expressing cells arise from E-cadherin-deficient cells.
22205962 E-cadherin could be upregulated by the suppression of ZEB1 transcriptional repressor by miRNAs in vivo
22205702 the roles of STAT3 in colorectal cancer epithelial-mesenchymal transition and in STAT3-induced down-regulation of E-cadherin
22201124 The data demonstrate that Cdc6 acts as a molecular switch at the E-cadherin locus, linking transcriptional repression to activation of replication
22194161 genetic association studies in Han Chinese population: Data suggest that polymorphism in CDH1 (-347G>GA) is associated with increased susceptibility of papillary thyroid carcinoma (PTC); an SNP in CDH1 (-160C>A) appears protective against PTC.
22185284 E-cadherin is necessary for localization of DLG1 but not phosphorylated MEK2 to the midbody ring during cytokinesis.
22184339 Differential expression of E-cadherin has an important role in pathogenesis of endometriosis.
22178396 In senescent cells, the DNA damage response induces proteasomal degradation of G9a and GLP, histone methyltransferases, through Cdc14B- and p21(Waf1/Cip1)-dependent activation of APC/C(Cdh1) ubiquitin ligase.
22177047 The up-regulation of Ezrin and Moesin and the down-regulation of E-Cadherin were associated with the invasion and metastasis of papillary thyroid carcinoma.
22174153 The regulation, function, and implications of E-cadherin expression in these central orchestrators of the immune system.
22159220 Loss of decorin and E-cadherin accelerated colon cancer cell growth and invasion in Dcn(-/-) mice.
22158051 CRYAB functions to suppress nasopharyngeal carcinoma progression by associating with the cadherin/catenin adherens junction and modulating the beta-catenin function.
22158034 Snail1 enhances the binding of Akt2 to the E-cadherin (CDH1) promoter and Akt2 interference prevents Snail1 repression of CDH1 gene
22152476 studies uncover a cell-cycle-independent function of Cdh1, establishing Cdh1 as an upstream component that governs Smurf1 activity
22151306 examined integrin beta(1) , ECAD and rac1 expression in SCLC and analyzed the prognostic value of these markers
22133296 Membranous E-cadherin immunostaining and cytoplasmic COX-2 expression were observed in 74.3% and 68.6% of cases respectively.
22131169 upregulation of connexin 43 in glioma stem cells inhibited their capacity of self-renewal, invasiveness, and tumorigenicity via modulation of E-cadherin.
22131135 This study finds a new mechanism that miR-9 utilizes to decrease E-cadherin expression and inhibit melanoma progression
22126395 The combination of E-cadherin and Ki67 status might be a useful prognostic marker indicating the need for adjuvant chemotherapy in Stage II TNBC patients.
22119833 The E-cadherin expression was reduced to negativity in advanced stages of gastric carcinoma.
22085498 The regulation and role of E-cadherin during melanoma development is the focus of this review. [review]
22080244 Loss of E-CD expression is an early event in lobular neoplasia of the breast.
22079356 E-cadherin nuclear staining is useful in distinguishing between adult granulosa cell tumors and ovarian adenocarcinomas or carcinoid tumors
22075503 Cholangiocarcinoma cell lines express E-cad and beta-cat but with different localizat- ion patterns.
22072429 E-cadherin is extensively expressed by oropharyngeal squamous cell carcinoma, even the non-keratinizing type, but our results suggest that cadherin expression may not be a predictor for nodal or distant metastasis in these tumors.
22069487 Loss of E-cadherin is associated with invasion in esophageal cancers.
22049025 PIPKIgamma and phosphatidyl inositol phosphate pools at nascent E-cadherin contacts cue Exo70 targeting and orient the tethering of exocyst-associated E-cadherin
22038626 results showed that NOTCH1 affected skin cancer cell motility by changing the expression of E-cadherin
22031287 p120 dynamically regulates Rho-GTPase activity at the E-cadherin complex through transient interaction with several of its up- and downstream effectors, including ROCK1
22020340 Study concludes that Smad3 regulates, at the transcriptional level, miR-200 family members, which themselves regulate ZEB1 and ZEB2, known transcriptional repressors of E-cadherin, at the posttranscriptional level in a TGF-beta-independent manner.
22012768 there are correlations between beta-catenin and TNM stage of colorectal cancer; there are greater amounts of beta-catenin in patients with deeper invasion of the tumor in colon layers, lymph node involvement as well as in patients with distant metastasis
22007144 E-cadherin/beta-catenin complex and the epithelial barrier
21997289 Certain CDH1 gene promoter -160 C > A and -347 G > GA variants might affect the susceptibility of colorectal cancer.
21993233 PLGA was successfully confirmed to support parotid gland acinar cells to form more post-confluence structure by enhancing E-cadherin expression.
21990317 E- and N-cadherins are expressed at the surface of human beta-cells and that these adhesion molecules are involved in the maintenance of beta-cell viability
21985494 Our findings suggest further investigation into the prognostic role of E-cadherin in pediatric Colorectal adenocarcinoma
21975680 Low E-cadherin is associated with metastasis in colorectal cancer.
21939503 Downregulation of E-Cadherin enhances proliferation of head and neck cancer through transcriptional regulation of epidermal growth factor receptor
21937720 study presents evidence that in the cadherin-catenin complex alpha-catenin contributes to the binding strength of another catenin, p120, to the same complex; data suggest that alpha-catenin-p120 contact within the cadherin-catenin complex can regulate cadherin trafficking
21916701 Dietary intakes of folate, vitamins B2, B6, B12, and methionine were not associated with likelihood of promoter methylation of E- cadherin, p16, and RAR-beta2.
21886810 Ect2 is subject to proteasomal degradation after mitosis, following ubiquitination by the APC/C complex and its co-activator Cdh1
21884207 Nuclear translocation of beta-catenin synchronized with loss of E-cadherin in oral epithelial dysplasia with a characteristic two-phase appearance
21884196 E-cadherin,alpha-dystroglycan and beta-dystroglycan levels were decreased in the oesophageal primary tumour samples, despite the presence of normal levels of dystroglycan mRNA.
21850251 Results demonstrate that the increase in E-cadherin mobility is constitutively altered by the presence of CAR at FLCARMCF7 cell junctions.
21849546 E-cadherin is effectively restricted to supporting cell (SC)-SC junctions in human and murine vestibular epithelia
21804545 Data show that EphB receptors interact with E-cadherin and with the metalloproteinase ADAM10 at sites of adhesion.
21798735 TGF-beta1-induced activation of Smad3 is the critical step for the uPA upregulation and E-cadherin downregulation
21792768 CDH1 gene promoter methylation may lead to aberrant expression of E-cadherin and beta-catenin in colonic carcinoma, and may play an important role in promoting tumor invasion.
21789704 Cath-D and E-Cad essays may useful in identifying neck lymph node involvement.
21782323 Results suggest that decreased E-cadherin and increased MMP-2 may be associated with the capacity of GCSCs to metastasize.
21781454 Expression of E-cadherin is downregulated, and expression of P-cadherin is upregulated in oral mucosa of mucous membrane pemphigoid (MMP), which may be involved in the pathogenesis of MMP.
21777391 Data suggest that regulation of E-cadherin expression in proximal tubule cells involves TGFb1IRS2FoxO3a pathway: IRS2 expression represses basal E-cadherin expression; Foxo3a phosphorylation is important for TGFb1-induced repression of E-cadherin.
21777349 This is the first report of CDH1 germline truncating mutations in Japanese patients with familial gastric cancer.
21775056 Data show that CD99 combined with E-cadherin/beta-catenin and CD10 can be used as a relatively specific expression profile of SPTs.
21768287 The Cells lacking Cdh1 have been shown to accumulate deoxyribonucleic acid (DNA) damage, suggesting that it may play a previously unrecognized role in maintaining genomic stability.
21765937 Cas proteins do not affect E-cadherin transcription, but rather, BCAR1 and NEDD9 signal through SRC to promote E-cadherin removal from the cell membrane and lysosomal degradation.
21752154 E-cadherin was decreased by EGF, but increased by luteolin and quercetin.
21746881 Data suggest that the TBX2/NRAGE complex protects cells against anoikis by downregulating p14ARF, representing a novel pathway for the regulation of anoikis by epithelial-to-mesenchymal transition and E-cadherin.
21744425 We confirmed the association between ulcerative colitis and CDH1.
21730131 E-cadherin-mediated cell-cell contact directly regulates the Hippo signaling pathway to control cell proliferation.
21716326 Suppression of E-cadherin function drives the early stages of Ras-induced squamous cell carcinoma through upregulation of FAK and Src.
21706058 Results sugggest that histone deacetylation of E-cadherin (CDH1) and downregulation of miR-373, together with the hypermethylation of CDH1 by hepatitis B virus-encoded X antigen, HBx, may be important for the understanding of HBV-related carcinogenesis.
21686228 H1 and PAR2 receptors enhance delivery of immune-competent cells and molecules by interrupting E-cadherin adhesion in lung epithelial cells.
21685945 The results uncovered a novel function of Rack1 in maintaining the junctional homeostasis of intestinal epithelial cells by regulation of the Src- and growth factor-induced endocytosis of E-cadherin.
21685935 Data suggest a critical role of EZH2 in the control of cell invasionand/or metastasis by forming a co-repressor complex with HDAC1/HDAC2/Snail to repress E-cadherin.
21681822 although genetic loss of Brca1 and E-cadherin are infrequent in breast cancer, they are down-regulated at the transcriptional level by CtBP1 expression.
21678109 Abnormal expression of E-cadherin, beta-catenin, Wnt-1 was observed.
21664858 In the current study of patients with tongue cancer, decreased E-cadherin and increased vimentin were found in spreading tumor satellites
21656704 E-cadherin expression in adenocarcinoma cells is regulated by slug.
21640770 These findings suggest that hepatitis C virus core protein could play a role in hepatocellular carcinoma at least in part by altering the methylation status of CDH1 promoter in hepatocytes.
21639893 These data suggest that loss of E-cadherin expression is associated with increased lymhogeneous metastasis of HNSCC.
21632186 No association was found between E-cadherin immunoreactivity and nodal metastasis in oral tongue squamous cell carcinoma.
21625863 The A allele of the CDH1 -160 C/A polymorphism confers a decreased stomach cancer risk in Asians but not in Caucasians.
21625458 elevation of E-cadherin, a cell adhesion molecule and suppression of beta-catenin, a proto-oncogene have been observed in presence of CaSR agonists whereas reverse effect has been seen in presence of CaSR antagonist
21613543 these findings show that epithelial-mesenchymal transition and its down-regulated expression of E-cad circumvent breast cancer dormancy in part by facilitating beta1 integrin expression necessary for metastatic outgrowth.
21612411 the role of the C-160A single-nucleotide polymorphism (SNP) of CDH1 in susceptibility to gastric cancer
21596315 The deubiquitinase USP37 binds CDH1 and removes degradative polyubiquitin from cyclin A. USP37 was induced by E2F factors in G1, peaked at G1/S, and was degraded in late mitosis. Phosphorylation of USP37 by CDK2 stimulated its full activity.
21595730 Corticotroph tumour progression was associated with reduced expression of the epithelial marker E-cadherin.
21574102 When both E-cadherin and beta -catenin expressions were reduced, there was a significant unfavourable prognosis.
21570316 Data suggest that CDH1 -160C>A gene polymorphism may contribute to increased risk of gastric cancer among Caucasians[meta-analysis]
21557297 Activation of epidermal growth factor receptor promotes squamous carcinoma cell migration and invasion via inducing epithelial mesenchymal transformation-like phenotype change and matrix metallproteinase-9-mediated degradation of E-cadherin
21552209 Among patients undergoing pancreaticoduodenectomy for pancreatic ductal adenocarcinoma, partial loss of tumoral E-cadherin expression is an independent predictor of poor outcome
21546539 E-cadherin has a role in antimigratory and antiinvasive efficacy of silibinin in prostate cancer cells
21540309 CDH1 polymorphisms are associated with epithelial E-cadherin expression contributor to airway remodelling and lung function in asthma.
21528083 Data suggest that SPARCL1, Shp2, MSH2, E-cadherin, p53, ADCY-2 and MAPK are potential prognostic markers in colorectal cancer.
21525715 MMP20 may influence ameloblast developmental progression through hydrolysis of cadherin extracellular domains with associated release of transcription factor(s).
21519872 Loss of E-cadherin is associated with triple-negative breast cancer.
21514270 These results indicate that PIPKIIbeta-mediated PI(4,5)P(2) signaling is important for E-cadherin upregulation and inhibition of cellular motility induced by VDR activation.
21509572 Our results indicate that the cadherin switch alters through progression of ovarian high-grade serous carcinoma .
21497201 APC/CCdh1 is a master G0/G1 regulator and involved in differentiation and development processes. (Review)
21493295 Cancerous tissues from 30 patients with HPSCC were examined for LOH in 4 tumor suppressor genes (TSGs) (p16, Rb, E-cadherin, and p53) at loci 9p21, 13q21, 6q22, and 17p13, respectively, using microsatellite markers amplified by polymerase chain reaction.
21480261 High E-cadherin is associated with metastatic lymph nodes of esophageal squamous cell carcinoma.
21478913 These findings show an important role for p53 in the progression of serous borderline ovarian tumors to an invasive carcinoma, and suggest that downregulation of E-cadherin by DNMT1-mediated promoter methylation contributes to this process.
21472888 These results suggest that CDH1-347 polymorphisms are associated with increased risks of oral cancer, and may be a predictive factor for tumor lymph node metastasis.
21462191 Single nucleotide polymorphisms in the CDH1 gene promoter is associated with development of hepatocellular carcinoma.
21459793 germline variants in the CDH1 gene contribute to a predisposition to the development of primary gastric diffuse large B-cell lymphomas.
21442485 There was a positive correlation between STAT3 and vimentin expression and a negative correlation between STAT3 and E-cadherin in colon cancer.
21438909 Down-regulation of E-cadherin and the up-regulation of nuclear beta-catenin expression might be crucial steps during tumour progression of tonsillar carcinomas.
21432908 These results suggested that the 3'-UTR +54C/T polymorphism in CDH1 may be a marker for genetic susceptibility of cancer.
21426663 The expression of E-cadherin was positively correlated with differentiated degree and lymphatic metastasis.
21424370 CDH1 mutation are associated with signet ring cell adenocarcinoma of the stomach.
21387286 expression of E-cadherin was shown to be a predictor of response to trastuzumab-based treatment for HER2-overexpressing carcinomas
21377268 Our data demonstrate that PIK3CA is a mediator of collagen I-induced down-regulation of E-cadherin.
21371426 Fyn, a member of Src family tyrosine kinases, plays a critical role in mediating TGF-beta1-induced down-regulation of E-cadherin in human A549 lung cancer cells.
21364589 Kras(G12D) allele promotes metastasis in pancreatic cancer cells partly through the downregulation of E-cadherin.
21356067 The CDH1 gene was screened for mutations in well-characterized, Finnish, high-risk hereditary breast and/or ovarian cancer individuals.
21350711 Data suggest that SDF-1 down-regulates the E-cadherin/beta-catenin complex expression in HT29 cells by decreasing mRNA synthesis and increasing beta-catenin phosphorylation.
21323952 A reduction in the expression of E-cadherin was observed in vulvar squamous cell carcinoma
21316706 activated STAT3 signal may associate with Twist and E-cadherin expression and mediate HCC invasiveness and metastasis.
21315774 This study demonstrates that ataxin-1 occupies the promoter region of E-cadherin in vivo and that ataxin-1 activates the promoter in a CtBP2-mediated transcriptional regulation manner.
21299609 Nuclear translocation of E-cadherin might contribute to ovarian folliculogenesis or granulosa/stromal cell differentiation.
21297666 the loss of E-cadherin itself may contribute to dysregulated PI3K/Akt signaling through its effects on PTEN.
21283129 Hakai mediates E-cadherin ubiquitination and degradation triggered by Slit-Robo signaling during colorectal epithelial cell carcinogenesis.
21274735 in patients with gastric caancer, expression of E-cadherin and that of Slug were associated with tumor properties, including lymph node metastasis, stage, lymphatic invasion, and venous invasion, as well as with prognosis
21271559 Germline CDH1 mutation can be cosegregated with ILBC in the absence of DGC.
21264536 The expression of vascular endothelial growth factor C in ovarian cancer was related to matrix metalloproteinase-2 and E-cadherin.
21258409 Data show that miR-495 expression was directly modulated by transcription factor E12/E47, and promotes oncogenesis via downregulation of E-cadherin and REDD1.
21241890 Study shows that nuclear PTEN interacts with APC/C, promotes APC/C association with CDH1, and thereby enhances the tumor-suppressive activity of the APC-CDH1 complex.
21240516 Reduced levels of E-cadherin protein observed in nasopharyngeal carinoma may play an important role in invasion and metastasis.
21239043 Combined dysadherin-positive expression and E-cadherin-negative expression may be valuable information for predicting aggressive tumor behavior of differentiated-type gastric carcinoma with submucosal invasion
21233674 E-cadherin appears to be a strong predictor of N stage in CRC and should be considered in pre-operative and post-operative management of colon and rectal cancer patients.
21215101 E-cad could enhance adhesion and inhibit proliferation of human breast carcinoma cells through a pathway involving beta-cat and cyclin D1.
21214416 Variant genotypes of the -160C>A polymorphism were associated with significantly decreased gastric cancer risk among Asians.
21196339 Brain metastases originating from lung adenocarcinoma and small cell lung cancer were significantly associated to E-cadherin genetic changes.
21186364 Substrates are recruited to the Anaphase-promoting complex by binding to a bipartite substrate receptor composed of Cdh1 and Doc1.
21184735 these data demonstrate that HDAC1 is a major repressive enzyme for E-cadherin expression as well as HDAC inhibitor-mediated anti-invasiveness.
21166752 Significantly lower distribution of E-cadherin was seen in interstitial cystitis/painful bladder syndrome bladder tissue compared to control patients
21161401 There is no association between the CHD1 gene 3'-UTR C/T polymorphism and nephrolithiasis in our population.
21151980 Dsg3, as an up-stream regulator of Src activity, helps regulate adherens junction formation through its interaction with E-cadherin
21143205 low expression of E-cadherin contributes to the vigorous growth and transforming ability of leukaemic cells
21138866 Foxo3a suppression of urothelial cancer invasiveness through Twist1, Y-box-binding protein 1, and E-cadherin regulation.
21119364 E-cadherin is a useful prognostic marker for ovarian clear cell adenocarcinoma patients, and paclitaxel-based chemotherapy can improve survival among patients with positive E-cadherin immunoreactivity.
21098640 p38 maintains E-cadherin expression by suppressing TAK1-NF-kappaB signaling, thus impeding the induction of epithelial-to-mesenchymal transition in human primary mesothelial cells.
21071539 Observational study of gene-disease association. (HuGE Navigator)
21055032 Aberrant methylation around gene promoter region may play an important part in down regulation of E-cadherin in nasopharyngeal carcinoma.
21047437 The epigenetic change in E-Cadherin and Cyclooxygenase-2 is associated with chronic periodontitis.
21045155 Data show E-cadherin molecular dynamics in vivo following perturbation of integrin signaling by inhibiting focal adhesion kinase (FAK) and Src.
20977688 These data provide novel insights into the tumor-suppressor function of E-cadherin, which contributes to the suppression of c-Jun protein translation and transcriptional activity.
20974127 Galpha(12) binds to p120(ctn) and modulates its phosphorylation status through a Rho-independent mechanism. Galpha(12) emerges as an important regulator of p120(ctn) function
20972463 GLI1-upregulated MUC5AC interfered with the membrane localization of E-cadherin, leading to decreased E-cadherin-dependent cell-cell adhesion and promoting the migration and invasion of pancreatic ductal adenocarcinoma cells.
20972462 findings show that p53 has an important role in the progression from serous borderline ovarian tumors to invasive carcinomas. In addition, our findings suggest that downregulation of E-cadherin by the PI3K/Akt pathway contributes to this progression
20946117 CTGF downregulated the expression of E-cadherin through activation of the nuclear factor-kappaappa B (NF-kappaB) pathway.
20937153 claudin-1 has anti-apoptotic effects, and is involved in the regulation of the expression and subcellular localization of beta-catenin and E-cadherin in MCF-7, but not T47 D cells
20933443 Data show that E-cadherin and alpha-catenin were predominantly expressed in the cell membranes, whereas beta- and gamma-catenin were found both in the cell membrane and cytoplasm.
20922573 Observational study of gene-disease association. (HuGE Navigator)
20921021 Potentially pathogenic germline CDH1 mutations in women with early-onset or familial lobular breast cancer are at most infrequent.
20921021 Observational study of gene-disease association. (HuGE Navigator)
20890948 ECAD inhibits Smad3/2 phosphorylation by recruiting RhoA to p120-ctn at the p120-ctn binding domain, whereas the loss of ECAD due to cadherin switching promotes the up-regulation of TGFbeta1 and its target genes, and facilitates liver fibrosis.
20880515 rs16260 overall genotype frequencies in cleft palate only groups were significantly different with controls and rs16260 AA genotype significantly increased risk of CPO by 5.90-fold, providing 1st evidence of CDH1 genetic variation in etiology of CPO.
20880515 Observational study of gene-disease association. (HuGE Navigator)
20874004 Hypermethylation of the CDH1 gene, resulting in low E-cadherin expression in endometrial carcinoma is associated with clinicopathological progress and the 5-year overall survival rate.
20871222 These results provide evidence that E-cadherin is expressed in a proportion of invasive lobular carcinoma of the breast, however, unlike ductal carcinoma, its expression seems to be of limited significance.
20871163 A negative correlation is found between Ezrin and E-cadherin expression in nasopharyngeal carcinoma tissues. Ezrin and E-cadherin are closely related to clinical staging and cervical lymph node metastases.
20865330 Loss of E-cadherin is associated with colorectal carcinoma.
20859650 plakoglobin and E-cadherin recruit plakophilin3 to the cell border to initiate desmosome formation
20844743 Observational study of gene-disease association. (HuGE Navigator)
20843706 metalloproteinase MMP-2 and MMP-9 -to-E-cadherin ratio has an effect on lymphangiogenesis and lymph node metastasis in prostate cancer
20842455 CDH1 gene mutation is not associated with hereditary diffuse gastric cancer.
20840677 Mutational analysis of E-cadherin, in synovial sarcomas
20819482 E-cadherin expression in nasopharyngeal carcinoma is negatively correlated with the numbers of the lymph node metastases and the metastasis distance.
20818341 Loss of E-cadherin expression may be a marker of plasmacytoid and signet ring cell differentiation in urothelial carcinoma.
20813963 E-cadherin proteolyis and nuclear translocation associates with aggressive foci growth only in the peritoneal microenvironment in colorectal cancer.
20811707 Suggest that TC21 promotes cell motility and metastasis by regulating the expression of E-cadherin and N-cadherin in hepatocellular carcinoma and is associated with tumor progression and poor prognosis in HCC.
20808826 PLEKHA7 is a cytoplasmic component of the epithelial adherens junction belt, distinct from ZO-1 and E-cadherin
20800513 Hypermethylation of E-cadherin is associated with recurrence of bladder cancer.
20734115 These results indicate that examination of CSE1L and E-cadherin distribution in colorectal epithelium glands may be valuable for evaluating the malignance of colorectal disease.
20729194 the sequential actions of the APC-c(Cdc20) and APC-c(Cdh1) ubiquitin ligases regulate the clearance of Mps1 levels and are critical for Mps1 functions during the cell cycle in human cells.
20719348 The majority of patients with germline CDH1 mutation have foci of noninvasive or invasive gastric cancer by middle age.
20714880 E-cadherin may be involved in the pathogenesis of chronic rhinosinusitis with nasal polyps and correlated with disease severity.
20712010 In lung carcinomas dysadherin expression seems to reflect tumour aggressiveness and may be considered a positive marker of poor prognosis when considered alone or/and in combination with down-regulation of E-cadherin.
20690797 induction of E-cadherin expression by small activating RNA leads to suppression of migration and invasion of PC3 prostate cancer cells.
20686030 Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.
20672350 Observational study of gene-disease association. (HuGE Navigator)
20668551 Data indicate that P-cadherin but not E-cadherin is important for maintaining adherens junctions in DU145 and MCF10A cells.
20659471 Observational study of gene-disease association. (HuGE Navigator)
20655775 Promoter methylation of DAPK1, E-cadherin and thrombospondin-1 in de novo and therapy-related myeloid neoplasms.
20651373 Analyses of CDH1 methylation suggested a significant difference between hypermethylated and non-hypermethylated samples, with a positive association between the -160 A allele and hypermethylation.
20651373 Observational study of gene-disease association. (HuGE Navigator)
20651370 IGF2*A allele and CDH1*C allele were correlated with leiomyoma susceptibility, which may be associated with leiomyoma development.
20651370 Observational study of gene-disease association. (HuGE Navigator)
20648012 Observational study of gene-disease association. (HuGE Navigator)
20638935 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20632448 Results suggests that the -160 AA genotype of human CDH1 is associated with an increased risk of gastric cancer in Oman.
20632448 Observational study of gene-disease association. (HuGE Navigator)
20631637 Overexpressions of nuclear E-cadherin is associated with non-small cell lung cancer.
20631633 Reduced expression of E-cadherin is associated with bronchioloalveolar carcinoma.
20605145 Expression of E-cadherin in endometrium and fallopian tubes from infertile women.
20596253 E-cadherin gene promoter hypermethylation was associated with low or absent expression of E-cadherin. Loss of E-cadherin protein may contribute to aberrant localization of beta-catenin.
20595808 the motility of E-cadherin within, and away from, the cell surface are not exclusive or independent mechanisms and there is a fine balance between the two which when perturbed can have dramatic effects on the regulation of Adherens Junctions
20584638 TGF-beta1 and E-cadherin are closely associated with the metastasis of ovarian carcinoma.
20582552 We suggest that COX-2 pathway reduces membranous E-cadherin expression in bladder transitional cell carcinoma
20581839 Data report that a nuclear-localized portion of the stress-activated kinase JNK is degraded by the APC/C(Cdh1) during exit from mitosis and the G1 phase of the cell cycle.
20574529 the potential involvements of E-cadherin and beta-catenin in meningioma
20573371 Our study suggests that E-cadherin down-regulation may lead to enhancer of zeste homologue 2-mediated invasion and metastasis.
20568901 Both P16 and CDH1 had different expression levels in tumor tissues compared to the adjacent normal tissues.
20563657 loss of E-cad expression in gastric cancer correlated with peripheral blood micrometastasis, lymph node metastasis, TNM stage, and lymphatic invasion.
20551954 in the 123 TNBC cases, the prognosis of patients with an E-cadherin-negative expression was significantly worse than that of E-cadherin-positive patients (P=0.0265), especially for those in clinical stage II (P=0.002).
20546345 Nuclear localization of E-cadherin in basal cell carcinoma is also associated with aggressive tumour features
20546336 Stromal CD10 expression and relationship to the E-cadherin/beta-catenin complex in breast carcinoma
20534996 PAS staining instead of H&E on CDH1 mutation-positive prophylactic gastrectomy specimens may increase the detection rate of adenocarcinoma while reducing screening time.
20530476 Observational study of gene-disease association. (HuGE Navigator)
20529828 The study objective was to assess changes in the expressions of E-cadherin and alpha-, beta- and gamma-catenin proteins in pancreatic duct carcinoma in correlation with clinicopathological parameters, lymph node involvement and distant metastases.
20529814 The E-cadherin-catenin complex is the factor indicative of metastasis and disease progression in gastric cancer.
20520968 Results suggest that CDH1 gene methylation and H pylori infection are frequent events in samples from Brazilian patients with chronic gastritis and reinforces the correlation between H. pylori infection and CDH1 inactivation in early gastric tumorigenesis
20518789 up-regulating expression of endogenous E-cadherin in breast cancer can inhibit proliferation, promote apoptosis, decrease mobility, and thus inhibit tumor growth in vivo.
20513387 individual cell movement, asymmetric colony expansion, Rho-associated kinase, and E-cadherin all influence embryonic stem cells clonogenicity, and provide additional guidance for improvement of clonogenic assays
20510078 Different expression patterns of E-cadherin and p120-catenin proteins can be helpful to distinguish infiltrating lobular carcinoma from ductal carcinoma of the breast.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20501757 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20474081 Reduced E-cadherin or beta-catenin negative expression relates to dedifferentiation and progression of nonsmall cell lung cancer
20473926 Elevated levels of serum E-cadherin is associated with late-stage colorectal carcinoma and familial adenomatous polyposis.
20471195 Novel heterozygous 2275G>T mutation(exon 14) of CDH1 gene detected in Iranian family with hereditary diffuse gastric cancer. The nonsense mutation generates premature stop codon(position 758)with truncated E-cadherin protein lacking cytoplasmic region.
20462505 Observational study of gene-disease association. (HuGE Navigator)
20453886 p140Cap immobilizes E-cadherin at the cell membrane and inhibits EGFR and Erk1/2 signalling, blocking scatter and proliferation of cancer cells.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20451421 Loss of E-cadherin expression is associated with non-muscle-invasive bladder cancer.
20437058 Observational study of genetic testing. (HuGE Navigator)
20432435 DDR1 can increase the stability of cell surface E-cadherin and promote MDCK cell aggregation, which may be mediated through the formation of DDR1/E-cadherin complexes.
20424596 Proteolysis of Rad17 by Cdh1/APC regulates checkpoint termination and recovery from genotoxic stress
20418909 ZEB1/BRG1 as a new transcriptional mechanism regulating E-cadherin expression and epithelial-to-mesenchymal transdifferentiation
20412959 Combined vorinostat and bortezomib therapy significantly decreased esophageal cancer epithelial-mesenchymal transition via E-cadherin up-regulation.
20410224 impaired down-regulation of E-cadherin and beta-catenin, along with Wnt/beta-catenin signaling pathway activation during the window of implantation, might be one of the potential molecular mechanisms of infertility in patients with endometriosis.
20403241 Low expression of E-CD and high expression of Snail are related to the advanced stage, and poor prognosis in colorectal cancer patients.
20398401 provide new evidence that HAb18G/CD147-mediated cell-cell contact confers anoikis resistance in an E-cadherin-dependent manner
20395298 DDB1 modulates the function of APC/C(Cdh1) in a manner independent of the Cul4-DDB1 complex
20388391 The expression of E-cadherin in invasive ductal carcinoma and carcinoma in situ was significantly higher than that in invasive lobular carcinoma.
20382636 e-cadherin is a prognostic factor for non-small cell lung cancer
20376482 Loss of E-cadherin expression was high in gallbladder cancer(67%), while majority of the chronic cholecystitis (94%) and xanthogranulomatous cholecystitis (91%) cases retained positive E-cadherin expression.
20375073 increased binding of DNMT3b to E-cadherin promoter region by K-Ras cause promoter hypermethylation for reduced expression of E-cadherin, leading to the decreased cell aggregation and increased metastasis of human prostate cancer cells.
20373058 increased expression of Cx43 and E-cadherin may contribute to the efficient metastasis of gastric cancer to the lymph nodes.
20357201 Observational study of gene-disease association. (HuGE Navigator)
20356845 Kruppel-like factor 4 inhibits epithelial-to-mesenchymal transition through regulation of E-cadherin gene expression
20335450 Reduced E-cadherin expression may correlate to a dedifferentiated phenotype in the somatotroph pituitary adenomas.
20332115 These findings indicate that independent control of E-cadherin expression and cell motility could be essential molecular events in p53 mutant-induced invasive phenotypes.
20219600 The results showed no differences in the expression of E-cadherin between tooth germs and solid and unicystic ameloblastomas.
20214550 E-cadherin expression predicts precancerous lesions of the larynx.
20204300 decrease of E-cadherin and the gain of N-cadherin gene expression are risk factors for cancer-related death in bladder cancer
20193117 The activation of Ezrin and the absence of E-cadherin contribute to the tumorigenesis and metastasis of esophageal squamous cell carcinoma.
20173740 miR-9 miRNA downregulates E-cadherin. Expression of miR-9 is activated by MYC and MYCN, which bind to the mir-9-3 locus. Elevated expression of miR-9 may contribute to epithelial-mesenchymal transition and metastasis in some and possibly many tumours.
20156840 L1 binding to ankyrin alters the regulation of neuronal branching and leads to a decrease in perisomatic synapses of GABAergic inhibitory interneurons in the developing transgenic mouse cingulate cortex.
20131016 High nonmembranous E-Cadherin expression was associated with advanced clinical stage, lymph node metastasis in nasopharyngeal carcinoma.
20118984 cadherin switching and p120(ctn) signaling as important targets of GnRH function and as novel mediators of invasiveness and tumor progression in ovarian cancer.
20116244 integration of Rac1 and Rab7 activities by Armus provides an important regulatory node for E-cadherin turnover and stability of cell-cell contacts
20113833 the AA (rather than CC) genotype of E-cadherin is associated with increased susceptibility and advanced pancreatic carcinoma in Chinese patients.
20113833 Observational study of gene-disease association. (HuGE Navigator)
20112731 E-cadherin and beta-catenin are differently expressed and distributed in prostate cancer cell lines with different characteristics of epithelial-mesenchymal transition.
20112504 Hypermethylation of E-Cadherin is associated with cervical carcinoma.
20101232 Data show there was a strong inverse correlation between slug and ERalpha and E-cadherin immunoreactivity in breast cancer cases.
20092957 one seminoma and three nonseminomas showed LOH of CDH1
20091050 E-cadherin showed a reciprocal staining pattern to ILK in 21 of 25 cases, with only focal expression of the marker in pancreatic adenocarcinoma.
20086175 Results indicate that cells underwent EMT exhibited overactive TGFbeta signaling and loss of expression of the CDH1, CGN, CLDN4, and KLK10 genes as a result of hypermethylation of their corresponding promoter regions.
20086044 an interaction between beta-catenin and vinculin is crucial for stabilizing E-cadherin at the cell surface
20082478 Gene methylation (CHFR, E-cadherin, BNIP3) in the peritoneal fluid could detect occult neoplastic cells in the peritoneum and might be a risk factor for peritoneal metastasis.
20080744 Glycolysis-promoting enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, isoform 3 (PFKFB3), is degraded by the E3 ubiquitin ligase APC/C-Cdh1.
20066101 Listeria monocytogenes internalin interacts with E-cadherin [review]
20053763 E-cad was profiled in the NCI-60 cancer cell lines at the DNA, RNA, and protein levels using six different microarray platforms plus bisulfite sequencing.
20049841 siRNA for HDAC3 reduced the cell migration with elevated E-cadherin expression
20048343 Differentiated prostate cell survival depended on E-cadherin and PI3K, but not keratinocyte growth factor, androgen, AR or MAPK.
20044998 The TLR9, IL6, and CDH1 variants all persisted as independent risk factors for post-infectious irritable bowel syndrome (PI-IBS) when controlling for previously identified clinical risk factors.
20038309 E-cadherin methylation plays an important role in the carcinogenesis of colon carcinoma cells, and can re-express after treatment with 5-Aza-CdR.
20033368 The results indicate that developmentof an invasive carcinoma from an intraductal papillary mucinous neoplasms of pancreas (IPMN) is associated with a decrease in tumor cells expressing E-cadherin and beta-catenin and higher proliferative activity.
20026874 molecular pathway from hypoxia to cellular transformation includes up-regulation of HIF and subsequent transcriptional induction of LOX and LOXL2, which repress E-cadherin and induce epithelial to mesenchymal transition
20025748 Evaluation of Twist and E-cadherin expressions should be useful for determining tumor properties, including prognosis, in patients with esophageal squamous cell carcinoma
20010527 Malignant drug resistant breast tumors are characterized by reverse relation between E-cadherin expression level and their proliferative activity
20007324 Either overexpression of a key regulator of cell cycle, Mad2, or knock down of Aurora B, an important kinase in mitosis, or Cdh1, a key E3 ligase in cell cycle, resulted in a significant increase of SP cells in CNE-2.
19998427 Cadherin can be used to discriminate between high- and low-risk papillomavirus in urethral cytologic specimens.
19965908 Allele-specific CDH1 downregulation and hereditary diffuse gastric cancer
19957556 CpG hypermethylation is an important mechanism of E-cad gene inactivation in ES-2 and SKOV3 ovarian carcinoma cell lines.
19957299 IBH-6 and IBH-4 breast cancer cells show down-regulation of E-cadherin expression with aberrant protein localization, and up-regulation of Twist; these features can be related to their invasive/metastatic characteristics.
19950699 In gastric carcinoma, up-regulation of CD147 and down-regulation of E-cadherin are in a negative correlation.
19948721 Results show that disruption of E-cadherin junctions and enhancement of cell invasion by beta-estradiol stimulation was mediated by NO-dependent activation of c-Src.
19940363 Immunohistochemistry on TMAs of 178 gastric cancers showed no correlation between COX-2 and E-cadherin expression in the conventional or early gastric cancer
19923077 Abnormality of E-cadherin expression was related to lymph node metastasis and advanced clinical stage of Her2-positive breast cancer.
19919954 the extracellular domains of E- and N-cadherin determines the basic localization pattern, whereas the cytoplasmic domains modulate it thereby affects the cell adhesion activity, subapical accumulation, and the formation of adherens junction.
19915572 CDH1 new susceptibility loci for ulcerative colitis
19915572 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19915524 The combination of the upregulation of vimentin and aberrant expression of E-cadherin/beta-catenin complexes at the tumour invasive front may provide a useful prognostic marker in oral squamous cell carcinoma.
19908344 The -347G-->GA promoter polymorphism in E-cadherin gene is associated with specific CRC features, and may be a prognostic factor rather than a susceptibility factor during the progression of CRC.
19908344 Observational study of gene-disease association. (HuGE Navigator)
19908067 Our results suggest that genetic instabilities of the E-cadherin gene have a role in meningioma development and progression
19901964 Data show that P-cadherin overexpression in breast cancer cells with wild-type E-cadherin promotes cell invasion, motility, and induces the secretion of MMP-1 and MMP-2, which then lead to P-cadherin ectodomain cleavage.
19894558 The abnormal expression of E-cadherin and P(120ctn) is closely related to the degree of differentiation, clinical stage and cervical lymph node metastasis in nasopharyngeal carcinoma.
19842844 no evidence for the presence of aberrant methylation sites of E-cadherin in tumors from patients with NSCLC
19839049 Up-regulation of E-cadherin by microRNA through direct targeting of transcriptional repressors of E-cadherin, inhibits tumor progression in breast cancer cells.
19834798 genetic variation in E-cadherin may be associated with breast cancer risk, and that this relationship may vary by menopausal status.
19834798 Observational study of gene-disease association. (HuGE Navigator)
19823035 these findings suggest that Cdh1 controls TACC3 protein stability during mitotic exit.
19802011 Histologically normal tissue adjacent to tumor tissue expressing the epithelial-mesenchymal transition-inducing gene SNAI1 shows alterations in the expression of epithelial differentiation genes such as CDH1 and VDR.
19802010 Data show that conversion of Ras-expressing keratinocytes from a premalignant to malignant state induced by decreasing E-cadherin function was associated with and required an approximately two to threefold decrease in RalA expression.
19799609 a decrease in CDH1, CDH13, and TIMP3 expression levels with an increase in CD44 can be used as an indicator for invasion in both ER-positive and -negative breast tumors.
19790246 The present findings point to a significant association between reduced E-cadherin expression and the progression and aggressivity of breast lesions.
19784072 Data show that elevated Snail expression by Pdcd4 knockdown leads to downregulation of E-cadherin resulting in activating beta-catenin/Tcf-dependent transcription.
19781162 CDH1 gene germ-line mutations are relatively rare in hereditary gastric cancer in China, whereas CDH1 somatic mutations and promoter methylation synergistically induce CDH1 downregulation in these patients.
19779262 The expression of RKIP and E-cadherin in prostate cancer tissues was obviously lower than that in the benign prostatic hypertrophy tissues.
19763914 In squamous cell lung cancer or lung adenocarcinomas, the abnormal cytoplasmic expression of p120ctn isoform 1 always correlates to the abnormal expression of E-cadherin.
19751508 aids in Wnt/beta-catenin signal transduction in invasive ductal carcinoma of breast
19748854 High methylation status of the 5' CpG island of E-cadherin gene may be one of the mechanisms in the development of gastric cardiac adenocarcinoma.
19745069 novel mechanism of E-cadherin gene inactivation, with CLL cells displaying a higher proportion of aberrant nonfunctional transcripts and resulting up-regulation of the wnt-beta-catenin pathway
19741544 Simultaneous analyses of fascin-1 and E-cadherin expression could be more effective in evaluating the prognoses of patients with laryngeal squamous cell carcinoma.
19726720 This study identifies the E-cadherin/catenin complex as a discriminative, partly polyamine-regulated feature of IL-4/IL-13-exposed alternatively activated macrophages
19711372 pH 6.6 activates Src kinases, resulting in tyrosine phosphorylation of E-cadherin and p120ctn and a weakening of the association of E-cadherin with p120ctn and contributing to the instability of E-cadherin at adherens junctions
19706751 the ability of CBX7 to positively regulate E-cadherin expression by interacting with HDAC2 and inhibiting its activity on the E-cadherin promoter would account for the correlation between the loss of CBX7 expression and a highly malignant phenotype
19703993 miR-200a appears to act as a multifunctional tumor suppressor miRNA in meningiomas through effects on the E-cadherin and Wnt/beta-catenin signaling pathways.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690775 E-cadherin and p63 are implicated in tumoral progression and may be used as a prognostic markers.
19690767 The main objectives were to assess tumor proliferation and invasiveness biomarkers (Ki-67, E-cadherin) and to identify potential correlation between biomarkers and classic prognostic factors in cervical cancer.
19671196 Investigated methylation status of the CDH1 promoter in gastric cancer patients. A difference was found between the methylation level of the two alleles in some samples, but there was no mono-allelic promoter hypermethylation in any of the samples.
19665015 Infection with H. pylori provokes shedding of the ectodomains of c-Met and E-cadherin. ADAM10 contributes to the shedding of c-Met and E-cadherin.
19661089 Observational study of gene-disease association. (HuGE Navigator)
19661031 Expression of E-cadherin was negative in all leiomyosarcomas.
19656157 increased E-cadherin and alpha-catenin expression and reduced Wnt signaling might be involved in the mechanisms of tumor suppressor function of BCSC-1.
19650189 Down reglation of E-cadherin is associated with rhabdomyosarcoma.
19646884 Data suggest that cadherin dimerization proceeds via an induced fit mechanism where the monomers first form a tryptophan-2 independent initial encounter complex and then undergo subsequent conformational changes to form the final strand-swapped dimer.
19641024 Data show that caveolin-1 and E-cadherin closely associated at cell borders and in internalized structures upon stimulation
19634113 E-cadherin and metalloproteinase-1 and -7 polymorphisms have roles in colorectal cancer
19634113 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19622294 Short-term preoperative treatment of celecoxib up-regulates the expression of E-cadherin in gastric carcinomas.
19620634 Data suggest that E-cadherin-based cell-cell adhesion limits Wnt signals by promoting the activity of a junction-localized beta-catenin phosphodestruction complex, which may be relevant to tissue morphogenesis and cell fate decisions during development.
19616845 Interstitial trophoblastic cell fusion and E-cadherin immunostaining in the placental bed of normal and hypertensive pregnancies.
19614771 MELF-type invasion represents a specific tumour alteration, and the reduction in hormone receptor and E-cadherin expression would be consistent with epithelial-mesenchymal transition.
19604491 E-cadherin may coengage KLRG1 and alpha(E)beta(7) and that KLRG1 overcomes its exceptionally weak affinity for cadherins through multipoint attachment to target cells, resulting in inhibitory signaling.
19604117 Using in vitro infection assays, the authors showed that Helicobacter pylori CagA interacts with E-cadherin, p120-catenin, and c-Met.
19603142 hMSCs caused breast cancer spheroids to become disorganized which was accompanied by a disruption of cell-cell adhesion, E-cadherin cleavage, and nuclear translocation of E-cadherin
19593637 cross-talk between ERalpha and EGFR could be extended to the modulation of E-cadherin expression by 4-hydroxytamoxifen and epidermal growth factor
19584296 Immunohistochemical analysis of E-cadherin and Zeb-1 in primary tumors confirmed that expression of the two proteins was mutually exclusive.
19584084 Mtation of E-cadherin influences Rac1 and Rho activation in opposite directions.
19572217 E-cadherin, a tumor invasion suppressor in HCC, was found to be a putative gene target of miR-9. E-cadherin was up-regulated by miR-9 inhibitor.
19569232 Data indicate CDH1-160C>A is a risk factor for CRC, and because a high proportion of the European population are carriers of at-risk genotypes, the variant is likely to contribute substantially to the development of colorectal cancer (CRC).
19563064 The C/C genotype of CDH1 might be a potential risk for cervical cancer development
19563064 Observational study of gene-disease association. (HuGE Navigator)
19551141 MMP1 and MMP3, but not CDH1, IGFBP3, STK15 or VEGF, appear to play roles in familial and sporadic renal cell carcinoma
19551141 Observational study of gene-disease association. (HuGE Navigator)
19549906 Studies show for the first time that DPAGT1 is an upstream regulator of E-cadherin N-glycosylation status and adherens junction composition and suggest that dysregulation of DPAGT1 causes disturbances in intercellular adhesion in oral cancer.
19536615 Results indicate that the expression of E-cadherin transcriptional repressors increased with malignancy in ovarian epithelial neoplasms.
19515834 Data show that overexpression of shrew-1 leads to preformation of an E-cadherin/EGF receptor/HER2/src-kinase/shrew-1 signaling complex and accelerated E-cadherin internalization.
19515043 e-cadherin is diminished in superficial koilocytotic cells' foci in Epidermodysplasia verruciformis
19506726 Meta-analysis of gene-disease association. (HuGE Navigator)
19497979 These results suggest that alpha(5)-integrin up-regulation induced by E-cadherin loss under hypoxia has a crucial role in regulating the migration of extravillous trophoblast cells.
19477924 Cdh1 reciprocally regulates the Rb pathway through competing with E2F1 to bind the hypophosphorylated form of Rb.
19474748 This report underlines that prophylactic gastrectomy remains the only option to eliminate the high risk for gastric cancer in CDH1 mutation carriers.
19465902 hepatocellular carcinoma with cirrhosis was characterized by a significantly low expression of E-cadherin
19458087 the tensile strength and the lifetime of single E-cadherin/E-cadherin bonds between parental cells are significantly lower over a wide range of loading rates
19457864 SFK and cortactin constitute an important signaling pathway that functionally links E-cadherin adhesion and the actin cytoskeleton
19446405 decreased expression of E-cadherin in upper urothelial carcinoma (UUC) in regions affected by Balkan Endemic Nephropathy tumors may be linked to tumor growth, while expression of E-cadherin in control tumors may be associated with tumor grade.
19440036 PRL-3 promoted downregulation of E-cadherin.
19432901 Novel role for shear in regulating the endocytosis of E-cadherin and invasiveness in metastatic esophageal cancer cells.
19420730 reduced syndecan-1/E-cadherin expression may be good indicators of recurrence and prognosis in extrahepatic bile duct carcinoma.
19417140 E-cadherin regulates both the PTEN protein levels and its recruitment to cell-cell junctions, which integrates proliferative and morphogenetic signaling in breast epithelial cells.
19411307 alpha(2)-, alpha(3)-, and beta(1)-integrins and E-cadherin expression in normal human lung and bronchopulmonary sequestration and congenital cystic adenomatoid malformation were evaluated using Western blot and immunohistochemistry.
19403558 MGAT3 and MGAT5 competitively modified E-cadherin N-glycans.
19398441 results demonstrate an association between polymorphisms within the CDH1 (E-cadherin) gene and Crohn's disease, which leads to cytoplasmic accumulation of E-cadherin instead of its normal localisation at the plasma membrane/adherens junction.
19398441 Observational study of gene-disease association. (HuGE Navigator)
19396152 Downregulation of E-cadherin and diffuse membranous beta-catenin expression suggest a dysregulation of the E-cadherin/beta-catenin complex in Merkel cell carcinoma.
19395181 aberrant expression of E-cadherin may contribute to cell motility and invasion in breast tumors
19389926 changes in the Akt/beta-catenin pathway play key roles in the regulation of E-cadherin through the transactivation of the Slug gene in uterine carcinosarcomas.
19383788 these results suggest a novel role for the ERalpha that plays the dual role of ligand-independent activator and ligand-dependent repressor of E-cadherin in breast cancer cells.
19379710 This review highlights recent advances in defining the mechanisms that regulate E-cadherin expression in breast cancer.
19375306 Meta-analysis of gene-disease association. (HuGE Navigator)
19372377 E-cadherins engaged at junctions do not directly revert to free membrane diffusion
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19350629 Low Cdh1 expression is associated with breast cancer.
19339270 Observational study of gene-disease association. (HuGE Navigator)
19336864 Loss plays an important role in progression of oral squamous cell carcinoma, that is, down regulation of its expression is associated with de-differentiation and metastasis
19324354 N- and E-cadherin expression in the human fetal ovary indicates likely roles in gonadal development from germ cell proliferation to primordial follicle formation, as well as in the development of the urogenital ducts of both genders.
19321195 up-regulation of E-cadherin is an early defining event in ovarian cancer and may play a significant role in the initial development of the primary ovarian tumor
19308044 NGAL overexpression altered subcellular localization of E-cadherin and catenins and decreased E-cadherin-mediated cell-cell adhesion.
19302290 core fucosylation regulates the processing of oligosaccharides and turnover of E-cadherin
19293150 p190RhoGAP and p120ctn associated predominantly on the plasma membrane of cells overexpressing E-cadherin, and that E-cadherin-bound p120ctn contributed to RhoA inactivation by favoring p190RhoGAP-RhoA association.
19290490 E-cadherin expression was reduced in hepatocellular carcinoma.
19276972 Collagen type I may influence the expression of E-cadherin and beta-catenin in carcinoma ex-pleomorphic adenoma.
19273195 data suggest that Dkk-1 stimulates the release of beta-catenin from cell membrane and facilitates cell migration which accompanies degradation of beta-catenin/E-cadherin
19269290 the different 2nd hits in CDH1 occurring in neoplastic lesions from hereditary diffuse gastric cancer patients was quantified
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247957 Results suggest that Ecad mutant forms lack some specific interaction shown by the wild type hEcad, and that these missing (or altered) interactions would play a role in tumour formation.
19244247 Data show that Wnt-5a stimulation of breast epithelial cells leads to increased cell-cell adhesion, and that Wnt-5a/casein kinase Ialpha (CKIalpha)-specific phosphorylation of beta-catenin leads to increased complex formation of beta-catenin/E-cadherin.
19223545 E-cadherin deficiency initiates gastric signet-ring cell carcinoma in mice and man.
19215686 uterine non-endometrioid (papillary serous and clear cell) carcinomas were less likely to express E-cadherin compared with endometrioid carcinomas and normal endometrial tissue
19193763 Cell separation or abrogation of E-cadherin-mediated cell-cell contacts both cause a dramatic increase in accumulation of the c-Jun protein.
19184677 ZO-1, occludin, and E-cadherin are downregulated in carcinomas arising from various compartments of the biliary tract
19181545 Hypermethylation of E-cadherin, p14 or RASSF1A in urine sediment DNA is a potential biomarker for detecting superficial, low grade cancer
19177462 Urinary soluble 80kDa fragment of E-cadherin has a potential clinical diagnostic value for diabetic nephropathy and E-cadherin may participate in the pathogenesis of DN.
19176757 Polyamines regulate E-cadherin transcription through c-Myc modulating intestinal epithelial barrier function.
19175984 Cell surface E-cadherin expression level was significantly lower in leukemia cells than in normal hematopoietic progenitors.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19168852 Germline deletions of CDH1 are one of the mechanisms underlying hereditary diffuse gastric cancer.
19162367 Abnormal p120-catenin expression correlates with abnormal E-cadherin expression and specific small GTPase overexpression, which contribute to the malignancy-related to NSCLC.
19158195 Cleavage of the extracellular domain and nuclear translocation of E-cadherin is a common event that may determine local invasion in pituitary adenomas.
19157508 the overexpression of epithelial cell adhesion molecule and reduced expression of E-cadherin in combination is more significant than a single marker for predicting poor survival.
19153669 E-cadherin, beta-catenin, and ZEB1 have roles in malignant progression of cancer [review]
19152244 E-cadherin truncation and sLeX overexpression are early events which may facilitate the tumor cells in oral cancer to metastasize
19151754 E-cadherin-mediated adherens junctions formation contributes to PI3K/AKT activation in epithelial ovarian cancer (EOC) by a mechanism that provides basis for therapeutic strategies that exploit PI3K inhibition to halt EOCs
19148529 of promoter hypermethylation of TIMP3, CDH1, DAPK, RASSF1A, p16INK4A and MGMT, only the epigenetic silencing of TIMP3 and CDH1 predicted a better outcome in head and neck squamous cell carcinoma
19137776 There was increased expression of E-cadherin and beta-catenin in the eutopic and ectopic endometrium in adenomyosis.
19122650 augmented production of HA and the decreased E-cadherin expression by keratinocytes stimulated with IL-4/IL-13 or IFN-gamma cause spongiosis in acute eczema
19121849 metastasis and survival of patients with bladder cancer are mediated, at least in part, by E-cadherin
19118778 The reduced immunoexpression of E-cadhedrin in the membrane may be related to the high degree of cell indifferentiation in cases of oral squamous cell carcinoma with high scores.
19110428 In polarized epithelial cells, E-cadherin regulates AMPK phosphorylation by controlling the localization of the LKB1 complex.
19085831 alterations in beta-catenin/E-cadherin complex play a critical role in spindle and/or corded (SPICO) cells' features
19082443 overexpression of SRF in colorectal carcinoma cells is associated with modulation of E-cadherin/beta-catenin expression and may play an important role in colorectal cancer metastasis.
19077564 The C-160A polymorphism is not associated with gastric cancer risk in the Italian population.
19077564 Observational study of gene-disease association. (HuGE Navigator)
19070520 N/E- cadherin expression profile has a significant prognostic value in invasive bladder cancer.
19056535 recruitment of E-cadherin expression by Connexin 43 and inhibits the malignant behaviour of lung cancer cells
19050681 Expression of p53, BCL-2 and Ki-67 was upregulated in clinically localized prostate cancer compared with benign prostate tissue, with no alteration in E-cadherin expression.
19048396 the over-expression of EphA2 or the down-expression of E-cadherin is correlated with cancer progression and lymphogenous metastasis in gastric cancer.
19048123 Ras transformation has at least two independent actions to disrupt E-cadherin junctions, with effects to cause both mislocalization of E-cadherin away from the cell surface and profound decrease in the expression of E-cadherin
19019843 E-cadherin was strongly expressed in urothelial cell carcinoma in situ (CIS) of the bladder.
19011631 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
18983973 The resistance of E-cadherin over-expressing cells to staurosporine may due to the up-regulation of Bcl-2/Bax ratio. When E-cadherin interference plasmids were transfected into MCF-7 cells, Bcl-2 expression was down-regulated.
18980977 We suggest that CDH1 cytoplasmic immunolocalization as a result of increased IGF-II levels identifies those nonmuscle invasive presentations most likely to recur
18976910 Reduced Cdh1 levels have no effect on destruction of many APC/C substrates during mitotic exit but strongly and specifically stabilize Aurora kinases.
18974268 E-cadherin plays an important role in uterine receptivity.
18937087 E-cadherin confer significantly different characteristics on cells.
18931551 Tissue and urine expression of E-cadherin in bladder transitional cell carcinoma are very closely associated with the biological behavior of the neoplasm.
18842495 In hepatocellular carcinoma (HCC), there is a negative correlation between the positive expression of p130Cas and the normal expression of E-cadherin/beta-catenin. p130Cas plays important roles in the invasion, metastasis and prognosis of HCC.
18837082 Reduced expression of E-cadherin/catenin complex in hepatocellular carcinomas.
18829543 Tbx2 and Tbx3 may play a dual role during the radial to vertical growth phase transition by both inhibiting senescence via repression of p21(CIP1) expression, and enhancing melanoma invasiveness by decreasing E-cadherin levels.
18829448 The results presented here describe the expression of E-cadherin in the male reproductive tract and gametes and strongly suggest its involvement in adhesion events during human fertilization.
18813944 Activated Akt seems to characterize well-differentiated invasive squamous laryngeal carcinomas, loss of E-cadherin and activation of beta-catenin correlated with high grade carcinomas.
18806748 The presence of E-cadherin in tumors correlated with the absence of metastases in regional lymph nodes and was observed, as a rule, in the patients at the early stages of the disease.
18801366 In human HCC tissues, we observed a correlation among ROS induction, E-cadherin down-regulation, Snail up-regulation, and E-cadherin promoter methylation.
18801083 Discontinuous staining of N-cadherin and loss of E-cadherin expression in hepatocellular carcinoma predicts a high risk of recurrence after surgical treatment.
18794357 the activated AR can downregulate E-cadherin expression to promote the activation of epithelial-mesenchymal transition and tumor metastasis.
18781193 Overall meta-analysis indicated that the -160A allele carriers (CA+AA) had a 21% elevated risk of prostate cancer, when compared with the homozygotes (CC) (OR=1.21; 95% CI: 0.97-1.51; P=0.090, Pheterogeneity=0.001).
18781193 Meta-analysis of gene-disease association. (HuGE Navigator)
18773488 ILK silencing inhibited binding of PARP-1 to SIRE
18772194 study demonstrated that E-cadherin missense mutants are subjected to Endoplasmic Reticulum Quality Control (ERQC) and that their loss is due to endoplasmic reticulum-associated degradation
18768510 The -347del allele of E-cadherin strongly links with the +178T and +234 13N ins alleles. The -347del/del genotype may increase susceptibility of sporadic gastric carcinoma among males in high-risk areas of China.
18768510 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18758239 Cdh1-dependent degradation of FoxM1 is required to shut down transcriptional activation of mitotic regulators during exit from mitosis.
18754040 cadherin-mediated cell-cell contact regulates early keratinocyte differentiation independently from changes in cell shape
18720887 The abnormal expression of E-cadherin and beta-catenin were closely related with differentiation, clinical stage, metastasis in laryngeal carcinoma.
18712716 significant association of concurrent expression of unmethylated E-cadherin gene and E-cadherin protein with metastatic prostate cancer cells in bone. May have role in intercellular adhesion in formation of metastatic lesions in bone.
18711702 Patients who had tumors with CDH1 hypermethylation had significantly better overall survival compared with patients who had tumors without hypermethylation (P < .02; log-rank test)
18710612 By inhibiting E-cadherin expression and enhancing ICAM-1 expression, LMP1 may reduce the cell-cell adhesive ability and improve the cell-matrix adhesive ability and migratory ability of nasopharyngeal carcinoma cells.
18705344 In the gastric cancerous tissues, the expression percentage of Wnt-1, beta-catenin and E-cadherin is 54.4%, 45.6%, 47.2%, respectively, which is significantly higher than the percentage expression of these genes in normal tissues (p<0.01).
18703780 important role of the E-cadherin/beta-catenin/Tcf signaling pathway in atherosclerosis.
18697202 hypermethylation of CDH1 and integrin alpha4 genes may be used as recurrence-associated prognostic indicators in stage I and stage II esophageal squamous cell carcinoma, respectively.
18691570 The significant difference in methylation of CDHE observed in liver neoplasms and liver cirrhosis was not observed in plasma samples.
18685493 loss of expression is related to bone metastasis in prostate cancer
18683894 Only borderline results for the association of AXIN2 and CDH1 with oral clefts with and without tooth agenesis.
18683894 Observational study of gene-disease association. (HuGE Navigator)
18677652 Increased dysadherin expression is possibly one of the post-transcriptional mechanisms responsible for E-cadherin downregulation in thyroid papillary neoplasia.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18674869 beta-catenin expression was significantly related to E-cadherin and MMP-7 expression
18662704 Results show a correlation of CDH1 and APC promoter methylation with loss of E-cadherin and APC proteins and with activation of Wnt/beta-catenin signaling pathway.
18655368 Decreased immunoexpression of beta-catenin and E-cadherin in serous ovarian tumors may be helpful in identifying the cases of higher metastatic potential and infiltration ability.
18646324 Sequence analysis of the high-frequency region along E-cadherin exons 7-9 revealed a number of sequence alterations in the patient group as a whole. A C insertion at nt 76,598 was found in 2 African American patients.
18632221 Hypermethylation of E-cadherin was found in 28 of 38 nasopharyngeal carcinoma
18624796 Results show that InlA triggers two successive E-cadherin post-translational modifications, the Src-mediated tyrosine phosphorylation of E-cadherin followed by its ubiquitination by the ubiquitin-ligase Hakai.
18618693 The Matrix Metalloproteinase (MMP-2, MMP-9) to E-cadherin (M/E ratio) characterizes an important aspect of the molecular phenotype associated with the histologic progression of prostate cancer among African American prostate cancer patients.
18593909 Rb depletion results in deregulation of E-cadherin.
18593713 rather than being translocated to the nucleus for regulating the target gene transcription, Smad7-stabilized-beta-catenin is shunted to the E-cadherin complex to modulate cell-cell adhesion.
18584348 Results suggest that histone H3 deacetylation plays a crucial role in transcriptional repression of E-cadherin in colorectal cancers.
18579802 Time-lapse microscopy in live cells showed that the recycling endosome is always requisite for E-cadherin sorting and trafficking.
18563342 E-cadherin may have a role in inhibition melanoma invasiveness by epigallocatechin-3-gallate
18559505 Loss of e-cadherin is associated with ovarian carcinoma
18553167 Core-fucosylated E-cadherin regulated nuclear beta-catenin accumulation in lung cancer cells.
18551395 Results suggest that a decrease in E-cadherin gene expression level in high-grade neuroepithelial tumors may be a hallmark of malignancy in dedifferentiated tumors and that it may be possibly correlated with their progression and dissemination.
18550473 loss of E-cadherin is probably consequent on p120 loss or decrease. Aberrations and other alterations of the E-cadherin gene are unlikely to be responsible for the loss of E-cadherin in solid pseudopapillary tumors.
18544073 Meta-analysis of gene-disease association. (HuGE Navigator)
18528437 Loss of E-cadherin-mediated adhesion led to acquisition of phenotypic properties that augmented cell motility and directed transition from precancer to cancer in skin-like tissues.
18516325 E-cadherine and CD44 immunoexpression in oral squamous cell carcinoma as prognosis factors.
18503162 data did not support a crucial role of promoter methylation of the E-cadherin gene in the remarkable downregulation of E-cadherin expression in colorectal cancers
18502615 results indicate that E-cadherin in the nevus cells of the giant congenital nevocellular nevi may affect nevus cell motility rather than intercellular attachment
18491227 N-glycosylation at Asn-633 is essential for E-cadherin expression, folding and trafficking.
18483246 E-cadherin loss in tumors contributes to metastatic dissemination by inducing wide-ranging transcriptional and functional changes
18482459 The CDH1 163+37235G>A polymorphism may represent a novel susceptibility variant for sporadic diffuse gastric cancer
18482459 Observational study of gene-disease association. (HuGE Navigator)
18469796 Reduced expression of E-cadherin may have a role to play in the pathogenesis of invasive Paget's disease of the vulva.
18468719 promoter-hypermethylation of E-cad is significantly associated with its defective expression and tumor differentiation in non-small cell lung cancer
18468719 Observational study of gene-disease association. (HuGE Navigator)
18459457 aberrant or decreased expression of E-cadherin seems to be one of most promising markers of poor prognosis in localized prostate cancer
18440840 Data show that loss of E-cadherin expression was independent prognostic factor for progression-free survival.
18434311 ADAM15 catalyzes the cleavage of E-cadherin to generate a soluble fragment that in turn binds to and stimulates ErbB receptor signaling
18427545 The nonsense-mediated-decay mRNA surveillance pathway downregulates aberrant E-cadherin transcripts in gastric cancer cells and in CDH1 mutation carriers.
18418437 Rsults suggest that the lower epithelial alpha-catenin, E-cadherin and (or) ZO-1 expression in patients with atopic asthma contributes to a defective airway epithelial barrier and a higher influx of eosinophils in the epithelium.
18411277 loss of expression of the miR-200 family members may play a critical role in the repression of E-cadherin by ZEB1 and ZEB2 during EMT, thereby enhancing migration and invasion during cancer progression.
18397460 study of correlation between mutations & expression of E-cadherin, beta-catenin, occludin & claudin & complexity of colon carcinoma growth; perturbed expression & distribution of these proteins was found, but could not be linked to complexity of growth
18393242 Data show that the haplotype the E-cadherin gene may have impact on the risk of epithelial ovarian carcinoma. The CC genotype of 3'-UTR + 54CT may be a potential risk factor for the epithelial ovarian carcinoma.
18393242 Observational study of gene-disease association. (HuGE Navigator)
18391748 superficial intramucosal signet ring carcinoma, although widespread, is predominantly located in the proximal one third of the stomach in patients with E-cadherin gene mutations.
18385519 transforming growth factor-beta1 indirectly reduces antigen-presenting cell density in EpM by affecting E-cadherin expression, which might explain the increased susceptibility of abnormal tissue differentiation.
18384629 The -160A, 234 2I allele and haplotype A-A-T-2I were risk factors of Transitional Cell Carcinoma of the Bladder. Haplotype C-A-T-I might act as a protective factor for TCCB.
18384629 Observational study of gene-disease association. (HuGE Navigator)
18381934 Cdh1 may act as an important component in tumor suppression and could be considered as a novel biomarker in breast cancer.
18379416 Positive staining for E-cadherin should not preclude a diagnosis of lobular in favor of ductal carcinoma.
18377425 This study provides into the mechanisms underlying the functional role of EZH2 overexpression in gastric cancer cells and a new modality of regulation of E-cadherin expression in silencing mechanisms of tumor suppressor genes.
18359784 Activin A downregulates E-cadherin expression in endometrial cells.
18349282 Methylation of CDH1 was present in 80% of NSCLC tissues but only in 14% of noncancerous tissues.
18342884 The heterotypic trans-interaction of LI- and E-cadherin might play a role during development of the intestinal epithelium when the cells do not yet have elaborate membrane specializations.
18342503 No CDH1 polymorphisms or haplotypes were associated with GC risk, no differences of effect were seen by H pylori infection. Three CDH1 polymorphisms in the same haplotype interacted with smoking to increase GC risk in smokers but not in never smokers.
18342503 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18339843 ASH1 inactivates DKK1 and DKK3, negative regulators of Wnt/beta-catenin signaling, E-cadherin, and integrin beta1 through ASH1-mediated deacetylation and repressive trimethylation of lysine 27 of histone H3 in the promoter regions of DKK1 and E-cadherin.
18330719 LIV-1 may be a regulator of E-cadherin
18330089 E-cadherin expressioni in adenomas suggest that this molecule might have role in adenoma formation though not necessarily be involved in neoplastic progression.
18327819 results indicate that Src and E-cadherin may play an important role in epithelial-mesenchymal transformations, invasion, and aggressive clinicopathologic features of head and neck squamous carcinoma
18325333 p35 co-expression targets E-cadherin to lysosomes and p35-triggered disappearance of E-cadherin precursor can be blocked specifically by lysosomal protease inhibitors, indicating p35 induces endocytosis and subsequent degradation of precursor E-cadherin
18321996 These results lead to a new hypothesis that Snail and ZEB1 are downstream of CCN6 and play a critical role in CCN6-mediated regulation of E-cadherin in breast cancer.
18319303 The disassembly of E-cadherin complexes from junctions in human keratinocytes was induced by Rac1 and Rac3 via activation of the Rac target PAK1.
18316097 levels in colon carcinomas were not statistically different from levels in adjacent normal mucosa and were not correlated with tumor, nodes, and metastases stage
18312357 Combined analysis of Cripto-1 and E-cadherin has significant value in evaluating the metastatic potential of gastric cancer and predicting patient prognosis.
18295959 Decreased E-cadherin may be important in the development of endometrial endometrioid carcinoma.
18279620 E-cad, CD44v6 and PCNA play important roles in invasion and metastasis of non-small cell lung cancer (NSCLC).
18276111 PTPRK influences transactivating activity of beta-catenin in non-tumoral and neoplastic cells by regulating the balance between signaling and adhesive beta-catenin, thus providing biochemical basis for the hypothesis of PTPRK as a tumor suppressor gene.
18256147 Vpu leads to the depression of both total and beta-catenin-associated E-cadherin levels through beta-TrCP-dependent stabilization of the transcriptional repressor Snail.
18256147 HIV-1 Tat C treated human brain microvascular endothelial cells result in downregulation and dissociation of VE-PTP and SHP2 from VE-cadherin
18250063 The abnormal expression of CDX(2) and E-cadherin plays an important role in the development of gastric carcinoma.
18246798 Expression of S100A4 protein and loss of E-cadherin protein expression are significantly associated with tumor progression in non-small cell lung cancer.
18245470 study describes activation of EGFR by mutant E-cadherin as a novel mechanism in tumor cells that explains the enhanced motility of tumor cells in the presence of an extracellular mutation of E-cadherin
18242180 Increased histone acetylation might be responsible for PGC-1alpha-mediated transactivation of a minimal E-cadherin promoter.
18235976 E-cadherin mutant missing N-glycans at Asn554, Asn566 and Asn618 failed to induce cell cycle arrest in G1 phase and to suppress cell proliferation in comparison with wild-type E-cadherin.
18234642 The expressions of aPKC-iota and E-cadherin may reflect the differentiation and invasive potential of cholangiocarcinoma
18223680 The E-cadherin-repressed hNanos1 gene induces tumor cell invasion by upregulating MT1-MMP expression.
18223216 Noncohesive pancreatic cancers were characterized by the loss of E-cadherin protein expression. Promoter hypermethylation is a possible mechanism of E-cadherin gene silencing in a subset of these cancers.
18200054 ADAM10-mediated E-cadherin proteolysis leads to the impaired cohesion of keratinocytes observed in eczematous dermatitis.
18197935 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18197935 The present study indicates that CDH1 single nucleotide polymorphisms might modify susceptibility to esophageal squamous cell carcinomas and gastric cardia adenocarcinomas
18196581 The CDH1 C-160A polymorphism is not associated with the risk of CRC in the German population
18196581 Observational study and meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
18192886 in solid pseudopapillary neoplasm of the pancreas E-cadherin expression moved from membranous to intracytoplasmic localization
18187454 Rac signaling to cyclin D1 is a crucial pro-proliferative effect of E-cadherin-mediated cell-cell adhesion
18183411 E-cadherin expression is frequently reduced in laryngeal squamous epithelium of patients with laryngopharyneal reflux.
18174259 the APC has a novel role in UV-induced cell death; APC/CDH1 is regulated through proteolysis
18158575 changes of Ecadherin (CDH1) and beta-catenin (CTNNB1) genes in two central nervous system germ cell tumors are reported; both germ cell tumors analyzed demonstrated LOH of the CDH1 gene
18097581 that the heterogeneous pattern of SCCA and E-cadherin in primary lesions is strongly associated with the high incidence of lymph node metastasis in cervical squamous cell carcinoma
18095267 Micrometastasis was significantly correlated with the depth of invasion, tumor size, operation method, Lauren classification, lymphovascular invasion and loss of E-cadherin expression in primary tumor.
18084253 in addition to the previously implicated tumor suppressor activity of E-cadherin, modified forms of this glycoprotein might also play a role in growth promotion
18065418 the CaR regulates cell survival and Ca(2+)(o)-induced differentiation in keratinocytes at least in part by activating the E-cadherin/PI3K pathway through a Src family tyrosine kinase-mediated signaling
18062917 Using transient promoter assays, we show that Twist can down-regulate E-cadherin promoter activity by up to two folds.
18062285 The expression of E-cadherin was significantly lower in supraglottic carcinoma than that in normal laryngeal mucosa.
18057010 Silencing Cdc42 blocks activation of EGFR and Src induced by Ca2+ depletion, resulting in a reduction in E-cadherin degradation
18046629 In most hereditary cancer syndromes, like hereditory diffuse gastric cancer and lobular carcinoma of the breast, multiple organ sites are affected by cancer and have been shown to be associated with germline mutations in CDH1 at 16q22.1.
18036402 A high frequency of hypermethylation was detected in CDH1 and SFN genes in tumoral and normal cortex tissues.
18035404 Observational study of gene-disease association. (HuGE Navigator)
18035404 The C/C genotype of 3'-UTR C/T SNP and -160C/-374GA haplotype in E-cadherin gene may be a factor for risk of epithelial ovarian cancer in Chinese; the lower expression of E-cadherin might play a role in the pathogenesis of epithelial ovarian cancer.
18024302 Galectin-3 and E-cadherin expressions are associated with lymph node metastasis of colon cancer.
18008331 membranous overexpression of E-cadherin and beta-catenin are associated with the metastatic prostate cancer cells in bone and the high frequency of expression suggests their involvement in the intercellular adhesion of the metastatic cells in bone
18006853 KCC3 down-regulates E-cadherin/beta-catenin complex formation by inhibiting transcription of E-cadherin gene and accelerating proteosome-dependent degradation of beta-catenin protein
17991426 Therefore, a loss of cell-cell junctions, a key process that occurs during the epithelial-mesenchymal transition, should have a broad impact on ER alpha transcriptional functions.
17991319 In colorectal adenocarcinoma, MUC1 expression was negatively correlated to E-cad expression, and MUC2 and MUC5AC expression were positively correlated to E-cad expression.
17991318 CpG island hypermethylation of E-cad gene exists in gastric cancer, which down-regulates E-cad expression and might be involved in tumorigenesis and development of gastric cancer.
17982235 analysis of Epstein-Barr virus, beta-catenin, and E-cadherin in gastric carcinomas
17981184 genetic predisposition plays role in hereditary diffuse gastric cancer
17979184 removal of N-glycans on E-cadherin resulted in elevated tyrosine phosphorylation level of beta-catenin and reduced beta- and alpha-catenins at adherens junctions
17979146 functional significance of combined dysregulation of PKD1 and E-cadherin in prostate cancer; their effect on cell growth is mediated by beta-catenin.
17971340 Observational study, meta-analysis, and HuGE review of gene-disease association. (HuGE Navigator)
17971340 -160A of the E-cadherin gene is emerging as a low-penetrance tumor susceptibility allele for the development of gastric, lung, prostate, and urothelial cancers.
17960794 The current findings suggested that simultaneous methylation of the E-cadherin and H-cadherin genes occurs in a subset of NSCLCs
17960397 Report a potential association of variants in the CCND1 and CDH1 genes with familial colorectal cancer using a unique study design with phenotypic extremes.
17960397 Observational study of gene-disease association. (HuGE Navigator)
17959171 Somatic E-cadherin mutations affect apoptosis regulation in that way that they can facilitate the disruption of adherens junctions thereby possibly influencing the response to cisplatin-based chemotherapy.
17940061 Data suggest that Dia1 localizes to and controls E-cadherin-mediated junctions in a RhoA-dependent manner.
17927866 E-cadherin expression is down-regulated in adenoid cystic carcinoma of the salivary glands, which is correlated to nerve invasion, regional recurrence and distant metastasis.
17906929 findings suggest E-cadherin-dependent cell-cell contact, directly or indirectly, mediates signal to undergo apoptosis of CaSki cells during multicellular tumor spheroid formation & provides new information on role of E-cadherin in cervix cancer apoptosis
17906660 there is an aberrant nuclear localization of E-cadherin in CC-RCC harboring VHL mutations, suggesting potential prognostic value of VHL and E-cadherin in CC-RCC.
17905526 This paper focuses on changes in E-cadherin (CDH1), adenomatous polyposis coli (APC), and beta-catenin (CTNNB1) in 50 tumors of the central nervous system
17873891 tumor-specific downregulation of expression and methylation of CDH13 and CDH1, alone or in combination, may be involved in the development and invasive growth of pituitary adenomas.
17852867 ATCTG and CTTTG CDH1 haplotypes may be associated with an increased risk and decreased risk, respectively, of gastric cancer in Japan.
17852867 Observational study of gene-disease association. (HuGE Navigator)
17850815 Comparison of the E-cadherin structure with other type I cadherin structures reveals features that are likely to be critical to facilitate dimerization by strand exchange as well as dimer flexibility.
17845801 Altogether, our results suggested that E-cadherin mediated cell-cell adhesion was essential for preventing the proteasome degradation of PTEN/
17828401 Reduced expression of E-cadherin was associated with short overall survival incolorectal neoplasms
17804733 Kallikrein 6 induces E-cadherin shedding and promotes cell proliferation, migration, and invasion.
17786966 Our results suggest that methylation of E-cadherin is a frequent, early event in gastric carcinoma progression. Two factors were ...associated with lymph node metastasis: abnormal expression of E-cadherin and lymphatic invasion
17785436 Re-expression of E-cadherin in HT29(US) cells restored the ability of caveolin-1 to down-regulate beta-catenin-Tcf/Lef-dependent transcription and survivin expression, as seen in HT29(ATCC) cells.
17764657 MUC1 may affect cancer cell migration by increasing E-cadherin/beta-catenin complex formation and restoring E-cadherin membrane localization
17761538 convincing evidence that cadherin adhesion is based on high-affinity cadherin-cadherin interactions
17760721 Our findings suggest that the hypermethylation of E-cadherin promoter might be involved in the process of gastric carcinoma through the specialized factors in H. pylori-induced enlarged fold gastritis.
17719574 These data suggest that serine/threonine phosphorylation of p120 influences the dynamics of E-cadherin in junctions.
17715295 Analysis of interface of In1a protein with E-cadherin to identify single amino acid substitutions in InlA that would potentially improve the overall quality of interaction and hence increase the weak binding affinity of the complex
17708604 E-cad expression in gastric carcinoma is relatively low in the internal obstruction of stagnant toxin type and the in-coordination between liver and stomach type.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17689924 These results demonstrate that lysophosphatidic acid regulates c-Met function through PKC delta and E-cadherin.
17689538 E-cadherin immunostaining was less intense in metaplastic cervical epithelial cells of women on tibolone, whereas hormone therapy and raloxifene were not associated with altered E-cadherin expression.
17685455 The E-cadherin gene methylation presence in tumors with lowest invasive and metastatic potential suggests the early involvement of this epigenetic event in the multistep progression of the oral carcinogenesis
17672949 Loss of E-cadherin expression is a risk factor for lymph node metastasis in early gastric cancer.
17671701 Expression may be reduced in some early gastric carcinomas.
17668349 The previously reported characteristics of this mutation, E-cadherin (V832M) do not apply to human epithelial cells expressing this mutant protein.
17663505 E-cadherin and beta-catenin have roles in progression of Epstein-Barr virus-associated gastric carcinoma
17660459 Observational study of genotype prevalence. (HuGE Navigator)
17660459 A novel germline CDH1 truncating mutation in the extracellular portion of the protein (517insA) was found in 2 relatives with lobular breast cancer. Germline CDH1 mutations can be associated with invasive LBC in the absence of diffuse gastric cancer.
17660246 a relation between the E-cadherin 3'-UTR C --> T polymorphism, the -160 A/-347 GA haplotype of two promoter polymorphisms and risk of endometriosis
17659469 The expression of E-cadherin was negatively correlated with lymphatic metastasis, clinical stage, and cancer differentiation in gastric cardia carcinoma.
17656222 Observational study of gene-disease association. (HuGE Navigator)
17656222 presence of the A allele of the -160C/A polymorphism in the E-cadherin gene may be a risk factor for prostate cancer in the Japanese population
17652530 Aberrant methylation of multiple genes (E-cadherin, estrogen receptor, RB1 , p16, p15, p14, and MGMT) is involved in gastric carcinogenesis.
17649807 there are significant differences of expression of E-cadherin between primary breast cancer cells and their metastases
17647062 High level E-cadherin expression and p120ctn localization were associated with esophageal squamous cell carcinoma differentiation and lymph node metastasis
17646933 Ep-CAM cross signaling with N-cadherin involves Pi3K, resulting in the abrogation of the cadherin adhesion complexes in epithelial cells.
17645803 The major subtypes of renal epithelial neoplasms display differential aberrant CDH1, PTGS2, and RASSF1A promoter methylation levels. This gene panel might contribute to a more accurate discrimination among common renal tumors.
17627624 Results show E-cadherin-mediated Listeria internalization requires Arp2/3 complex acts as an actin nucleator.
17627168 Observational study of gene-disease association. (HuGE Navigator)
17626746 The expression of aPKC-iota and E-cadherin may reflect the differentiation and invasive potential of cholangiocarcinoma.
17623668 Junctional adhesion molecule-A is critical for the formation of pseudocanaliculi and modulates E-cadherin expression in hepatic cells
17620337 E-cadherin thus requires both ankyrin-G and beta-2-spectrin for its cellular localization in early embryos as well as cultured epithelial cells.
17617594 study demonstrates that E-cadherin represents a ligand for KLRG1 and that ligation of KLRG1 by E-cadherin inhibited effector cell functions of polyclonal NK cells
17611682 NFkappaB activation mediated by loss of E-cadherin may represent an essential, even initial event in colorectal neoplasm metastasis
17608733 In addition to suppressing late-stage tumor progression, E-cadherin-mediated adherens junctions may also contribute to the initial emergence of a cohesive morphogenic phenotype that is a hallmark of differentiated epithelial ovarian carcinoma.
17605082 A tight control of E-cadherin expression depending on the differentiation stage of the progenitor cells, is suggested.
17593336 Aberrant E-cadherin expressions were described in several tumors such as in bladder cancer. This was also found to be correlated with tumor invasion and survival.
17576040 we explored the implication of three proteins (E-cadherin, a- and b-catenins) that form the cadherin-catenin complex, a receptorial structure strictly involved in tumoral vascular invasion and embolization in this biologic event
17553930 E-cadherin signaling is an important activator of c-Src at cell-cell contacts, providing a key input into a signaling pathway where quantitative changes in signal strength may result in qualitative differences in functional outcome.
17549573 Observational study of gene-disease association. (HuGE Navigator)
17549573 The C/A polymorphism of CDHE has a direct effect on the risk of diffuse gastric cancer at young age in Mexican population.
17548604 Downregulation of E-cadhedrin expression is associataed with increased EGFR downstream signalling and a subsequent increase in expression of Th2-attracting chemokine TARC.
17548247 Observational study of gene-disease association. (HuGE Navigator)
17548247 results of this study show no association exists between the E-cadherin genotype and the risk of tumor recurrence in Chinese patients with hepatocellular carcinoma
17545690 Recurrent CDH1 mutations in families with hereditary diffuse gastric cancer are due to both independent mutational events and common ancestry. The presence of a founder mutation from Newfoundland is strongly supported.
17520682 E-cad promoter methylation may play a role in tumor cell differentiation and perineural invasion.
17509026 While CDH1 methylation seems to be an early event in Hp gastritis, MLH1 methylation occurs late along with IM.
17507638 Characterization of endogenous CDHE-CTNNB complexes with ELISA represents a dramatic improvement over other assays.
17504810 Differentially regulated beta-catenin pools associate with the E-cadherin-gamma-secretase adherens junction complex; one pool regulated by gamma-secretase is important to intestinal epithelial cell homeostasis.
17502486 Together, these findings demonstrate a role for SNX1 in retrieval of E-cadherin from a degradative endosomal pathway and in membrane trafficking pathways that regulate E-cadherin recycling.
17437014 None of the 30 infiltrating lobular carcinomas cells showed preserved E-cadherin expression.
17434710 E-cadherin promoter hypermethylation was observed in the tumour of the P373L mutation carrier.
17431390 Decreased E-cadherin is asociated with thyroid cancer
17429067 Data show that E-cadherin/beta-catenin-based adherens junctions are dispensable for tight junction formation and apical lumen biogenesis but not for apical lumen remodeling.
17396032 incubation with HGF mediated the release of MMP-7, resulting in extracellular cleavage of E-cadherin from stomach cancer cells
17392517 Data show tha E-cadherin homophilic binding independent of other cell contacts directly transduces growth inhibition by a beta-catenin-dependent mechanism that inhibits selective signaling functions of growth factor receptors.
17383595 E-cadherin cleavage is enhanced by contact with C. albicans: intracellular cleavage generating substrate for gamma-secretase and extracellular cleavage temporally associated with increase in monolayer permeability.
17383052 CDHE was expressed in both tumor types, especially in the cytoplasm and cell membrane of the cuboidal cells and to a lesser extent in the polygonal cell membrane, where it was expressed mostly in the cytoplasm.
17341890 Decreased E-cadherin expression is associated with advanced gallbladder cancers
17339363 C. albicans invades mucosal tissues by promoting the proteolytic degradation of E-cadherin in epithelial adherens junctions, mediated by transcription factor Rim101 and Sap5 proteins.
17325197 Cadherin-E interaction with integrin alphaEbeta7 causes antitumor cytotoxic response by CD8+/CD103+ tumor-reactive T lymphocytes.
17294073 High Nonmembranous type E-cadherin expression correlated significantly with lymph node metastasis, distant metastasis, and recurrence regulated by hepatocyte growth factor
17272646 E-cad expression to be correlated with E-cad methylation at highly statistically significant levels. Above a threshold of approximately 20% to 30% mean methylation, the expression of E-cad was effectively silenced.
17261850 PIPKIgamma links E-cadherin to adaptor protein complexes
17242406 the recruitment of PI3K to the E-cadherin/beta-catenin/p120-catenin complex via beta-catenin at the plasma membrane is required for calcium-induced phospholipase C-gamma1 activation and, ultimately, keratinocyte differentiation
17237808 These results indicate that perturbation of the E-cadherin/beta-catenin complex by H. pylori CagA plays an important role in the development of intestinal metaplasia.
17224907 targeting constitutive expression of AP-2alpha in AP-2-positive KM12C colon cancer cells with small interfering RNA resulted in an increase in their invasive potential, downregulation of E-cadherin and increased expression of MMP-9
17221870 Seven novel mutations within the CDH1 gene are associated with Hereditary diffuse gastric cancer.
17214852 Found in in situ lesions. May play some role in the prognosis/invasion of extramammary Paget's disease.
17203182 alpha2-antiplasmin induction inhibits E-cadherin processing mediated by the plasminogen activator/plasmin system, leading to suppression of progression of oral squamous cell carcinoma via upregulation of cell-cell adhesion
17202846 Observational study of gene-disease association. (HuGE Navigator)
17201188 Observational study of gene-disease association. (HuGE Navigator)
17146437 E-cadherin repression is necessary for c-Myc-induced cell transformation.
17138130 Observational study of gene-disease association. (HuGE Navigator)
17130831 Cell cycle regulation of Six1 occurs both transcriptionally and post-translationally via phosphorylation
17126523 first CDH1 germline mutation of an Italian family with hereditary diffuse gastric cancer is reported
17062664 Real-time reverse transcription-PCR and Western blotting were used to assess levels of E-cadherin expression in esophageal cancer.
17060462 VHL promotes E2 box-dependent E-cadherin transcription by HIF-mediated regulation of SIP1 and snail
17050668 In conclusion, ROS play a central role in mediating TPA-triggered sustained PKC and ERK signaling for regulation of gene expression of integrins and E-cahedrin that are responsible for EMT and migration of HepG2.
17043655 SMAD family member 1 is involved in the progression of pancreatic cancer and plays a role in mediating signal transduction from collagen type I to downregulate E-cadherin expression.
17031402 Increased N-cadherin expression was found in pseudomyxoma peritonei.
17016656 SCCA2 regulates cell migration and invasion via E-cadherin expression, suggesting that SCCA2 may be involved in cancer behavior such as invasion or metastasis.
17015477 E-cadherin expression responds only to the combination treatment and not to single PPARgamma agonists, defining a new class of PPARgamma target genes
17013088 E-cadherin may sensitize human melanoma cells towards apoptosis
16949915 loss of extracellular E-cadherin observed in normal duodenal & colonic mucosa in patients familial adenomatous polyposis might play a role in high susceptibility of these tissues for (pre-) malignant transformation
16948518 Roles of E-cadherin and beta-catenin complexes in signet ring cell carcinoma of the lung differ from their roles in gastric or colorectal cancers.
16941960 The expression of TGF-beta1 and E-cadherin are correlated with lymph node metastasis in supraglottic larynx squamous cell carcinoma.
16934975 Observational study of gene-disease association. (HuGE Navigator)
16932944 the gain and not the loss of the E-cadherin axis contributes to the invasiveness of inflammatory breast cancer cells unique phenotype
16930554 dysfunction of E-cadherin due to its endocytosis may occur in some proportion of human breast carcinomas in which the PP2A-A protein is lost or significantly reduced
16930538 CD24 regulates E-cadherin and TGF-beta3 expression in cultured oral epithelial cells
16929514 Observational study of gene-disease association. (HuGE Navigator)
16927799 The expression of E-cad was significantly lower in endocrine inactive group than that in endocrine active group of pituitary adenoma.
16924464 A model is proposed to infer the pathogenic significance of CDH1 germline missense variants.
16922727 Observational study of gene-disease association. (HuGE Navigator)
16909210 Our results indicate a functional role of Met-E-cadherin interaction in MCF-7 cells through the amplification of the signaling downstream of HGF-Met triggering that involved c-Src and phosphoinositide-3-kinase activities.
16907861 CDH1 serum levels may be a serological marker for staging of patients with testicular germ cell neoplasia.
16870389 A novel mutation in the E-cadherin gene in a family with hereditary diffuse gastric cancer. The presence of a 1610delC germline mutation was confirmed.
16865770 Examination of E-cadherin expression and distribution in colorectal tumors can be extremely valuable in predicting disease recurrence.
16830381 E-cadherin/CDH1 gene methylation is an important cause for its gene silence in diffuse variant gastric carcinoma.
16826427 The mechanism underlying 5-Azacytidine's anti-metastasis activity is associated with restored functional expression of E-cadherin in ovarian cancer.
16819153 E-cadherin immunoreactivity was detected in all the epithelial tissues examined, except adrenal cortical cells and granulosa cells.
16813949 Observational study of gene-disease association. (HuGE Navigator)
16804902 Levels of expression of CtBP and p300 are critical for the action of SNAIL and ZEB1, which have a pivotal role in levels of epithelial-mesenchymsal transitionin human colon carcinoma.
16801346 Observational study of genotype prevalence. (HuGE Navigator)
16801346 CDH1 mutations are associated with a risk of early-onset gastric cancer.
16799706 No significant association between E-cadherin expression and tumor grade, stage, age or gender of the patients, the number of recurrences, or overall survival could be seen.
16786001 the degradation of E-cadherin in response to expression of R-cadherin is due to competition for p120(ctn)
16761612 E-cadherin has a role in head and neck squamous cell carcinoma [review]
16760429 These data suggest that endocytosis is the main pathway for the dissociation of E-cadherin adhesive dimers.
16732935 E-cadherin methylation was associated with the inhibition of E-cadherin gene and protein expression in acute myeloid leukemia.
16714334 Activation of protease-activated receptor-2 (PAR2) interrupted adhesion of E-cadherin-expressing L cells and of primary airway epithelial cells to immobilized E-cadherin extracellular domain. Activation of PAR2 interrupts E-cadherin adhesion.
16702959 E-cadherin pathway is a novel and functionally important mediator by which changes in Kruppel-like KLF6 tumor suppressor can directly alter ovarian tumor invasion and metastasis.
16699861 The high frequency of methylation of the CDH1 gene promoter suggests that the inactivation of tumor suppressor genes and of the genes related to the control of cellular proliferation through this mechanism is involved in gallbladder carcinogenesis.
16685438 Reduced E-cadherin expression is related to a poor prognosis through hematogenous metastasis in pulmonary adenocarcinoma.
16682529 Findings demonstrate a stimulatory role for E-cadherin in proliferative regulation, and identify a simple mechanism by which cell-cell contact may trigger or inhibit epithelial cell proliferation in different settings.
16614715 Serum levels may be a prognostic biological marker innonsmall cell lung cancer.
16608875 Data show that dynamic microtubules regulate the local concentration of E-cadherin at cell-cell contacts.
16596173 Loss of E-cadherin and Death Associated Protein kinase methylation and expression is more frequent in lymph node metastases of pancreatic adenocarcinoma
16574648 PCP-2 may play an important role in the maintenance of epithelial integrity, and a loss of its regulatory function may be an alternative mechanism for activating beta-catenin signaling.
16502042 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16495925 CDH1 promoter methylation, but not mutational inactivation, is part of an entire programme, resulting in epithelial-mesenchymal transition and increased invasiveness in breast cancer
16474379 Data suggest that tissue expression of E-cadherin could be a useful marker to predict the progression and metastasis of hepatocellular carcinoma.
16447040 Our present results show that gastric differentiated-type carcinomas have different characteristics according to the phenotypic marker expression of the tumour in terms of histological findings, E-cadherin expression and pattern of chromosomal changes.
16426911 decreased immunoreactivity of E-cadherin in esophageal squamous cell carcinoma was statistically correlated with presence of lymphatic metastases
16390868 Results suggest that loss of E-cadherin function is linked to regulation of cell-cell and cell-matrix adhesion, based in part on cell surface expression of alpha2, alpha3 and beta1 integrins.
16373333 Increase in HOXA1 expression in mammary carcinoma cells at full confluence is E-cadherin-dependent.
16372334 Observational study of gene-disease association. (HuGE Navigator)
16372334 CDH1 may be a low-penetrant prostate cancer susceptibility gene.
16368435 Data indicate that E-cadherin may modulate Wnt-dependent gene expression in DLD-1 colorectal cancer cells by regulating the availability of beta-catenin.
16367920 transforming growth factor-beta1 overexpression and alteration in E-cadherin/beta-catenin complexes in bladder urothelium might play a crucial role in urinary bladder carcinogenesis in humans exposed to long-term low-dose ionizing radiation
16344308 These results suggest that Scrib stabilizes the coupling between E-cadherin and the catenins and are consistent with the idea that mammalian Scrib could behave as a tumor suppressor by regulating epithelial cell adhesion and migration.
16338932 E-cadherin controls enterocyte-specific expression of genes, such as the apoA-IV gene, through the control of hepatic nuclear factor 4alpha nuclear abundance
16333245 In testicular tumours, as in other neoplasms, dysadherin downregulates E-cadherin expression, at least in part
16327305 Observational study of gene-disease association. (HuGE Navigator)
16327305 The CDH-1 gene 3'-UTR C/T polymorphism is associated with prostate cancer. The 'CC' homozygote indicates a relatively higher risk for developing prostate cancer than other genotypes.
16301117 expression of E-cadherin and beta-catenin is significantly down regulated in prostate cancer compared to surrounding benign appearing prostate, which correlates with increasing Gleason grade
16276119 Observational study of gene-disease association. (HuGE Navigator)
16276119 CDH-1 is closely related to metalloproteinase and plays important but not well-understood role in onset and progression of primary open angle glaucoma. Role could be resolved by posttranslated products of gene and protein-protein interaction.
16247464 Depressed E-cadherin correlates with HBxAg trans-activation function.
16237750 With tumor progression and development of heterogeneity, the abnormal expressions of MMP-9, TIMP-2, and E-cadherin or DNA aneuploid rate or high SPF gradually increases, suggesting that they play a crucial role in gastric carcinoma progression
16226258 Cell-to-cell communication mediated by E-cadherin contributes to the acquirement of a cardiomyogenic phenotype of human endothelial progenitor cells.
16226102 Increased expression of delta-catenin os associated with the down-regulation and redistibution of ECAD and p120ctn in prostatic cancer.
16219695 The TGFbeta(1)-induced destabilisation of E-cadherin-mediated cell-cell adhesion involves phosphorylation of beta-catenin, which is regulated by E-cadherin adhesion complex-associated PI3-kinase and PTEN.
16215948 -160(C-->A) polymorphism in CDH1 gene promoter region may not be in association with genetic susceptibility to gastric cancer in Chinese population from Fujian.
16215948 Observational study of gene-disease association. (HuGE Navigator)
16199889 inhibition of E-cadherin-dependent cell-cell adhesion led to the genetic reprogramming of tumor cells
16189707 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16189707 report strong confirmation of the association between prostate cancer risk in FH+ cases and a functional CDH1 promoter SNP in an independent population
16172196 E-cadherin protein was lost and mRNA levels were significantly decreased in prostate cancer cells expressing kallikrein 4 and prostate specific antigen.
16152579 loss of E-cadherin-mediated adhesion plays a causal role in the transition from low- to high-grade squamous cell carcinoma
16142450 The E-cadherin is a cell-cell adhesion protein expressed in cytotrophoblasts, which is lost as they differentiate and syncytialise.
16142373 E-cadherin may have a role in progression and recurrence of transitional cell carcinomas of the urinary bladder
16138013 upon infection of quiescent cells human cytomegalovirus not only activates the E2F-dependent G(1)/S transcription program but also facilitates protein accumulation of APC/C substrates by rapid Cdh1 dissociation
16132582 Reduced E-cadherin is a common genetic phenotype of gastric cancers and plays beneficial roles in tumor metastasis.
16127748 Observational study of gene-disease association. (HuGE Navigator)
16127748 Patients with the -160C/C genotype might require H. pylori infection to promote inactivation of CDH1, suggesting that H. pylori infection might affect gastric carcinomas in initial stage because polymorphism is germ line.
16123095 E-cadherin distribution in human embryos is stage-dependent
16061854 an E-cadherin germline mutation may have a role in development of hereditary diffuse gastric cancer
16061479 SIP1 sumoylation by Pc2 attenuates transcriptional repression of E-cadherin
16007161 expression at transcriptional level is repressed by HBV X protein
16002701 Domain 5 of E-cadherin may play a critical role in the regulation of heterophilic adhesion to integrin alphaEbeta7; domains 1, 2, 3, and 4 are involved in homophilic adhesion.
15958533 ADAM10 has a role in E-cadherin shedding and epithelial cell-cell adhesion, migration, and beta-catenin translocation
15943036 disturbances in the distribution of beta-catenin and E-cadherin might affect the morphology of adenoid cystic carcinoma
15937692 The entire cadherin-catenin complex is involved when assessing its prognostic value in colonic adenocarcinom.
15930343 Strong E-cadherin expression in lymph node metastases was highly predictive of improved survival.
15928314 E-cadherin may play a distinct role in the development of ovarian epithelial cancers.
15890089 Observational study of gene-disease association. (HuGE Navigator)
15857834 examined here the effect of trans-interacting nectin on non-trans-interacting E-cadherin endocytosis
15831593 These findings suggest that alteration of the E-cadherin pathway can contribute to human clefting.
15824172 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15809746 E-cadherin expression was significantly associated with higher tumour grade in colorectal carcinoma.
15780560 mutations cause inactivation of the cell adhesion protein E-cadherin; carriers of the CDH1 germline gene mutation develop an aggressive, diffuse, submucosal gastric cancer at an early age [review]
15777972 dysfunction of E-cadherin and nm23 has a role in progression of NSCLC
15750927 association between decreased expression and metastatic Wilms' tumor
15741307 Observational study of gene-disease association. (HuGE Navigator)
15718252 Disruption of E-cadherin-mediated cell-cell contacts at high cell density inhibits the induction of p27(kip1) and restores proliferation in contact-inhibited cells.
15713751 cadherin switching (downregulation of E-cadherin and upregulation of N-cadherin) is necessary for increased motility but is not required for the morphological changes that accompany the epithelium-to-mesenchyme transition
15709186 Tumors with reduced E-cadherin expression invaded deeper, had more lymph node metastasis, and had more lymphatic invasion than the tumors with preserved E-cadherin expression.
15696778 All 61 meningothelial meningiomas, 10 of 12 invasive meningiomas, and 3 of 5 anaplastic meningiomas were positive for both ECAD and beta-catenin, while these were both negative in all of the fibrous meningiomas.
15696125 Altered E-cadherin adhesion complex is an early event affecting atypical lobular hyperplasia as well as lobular carcinoma in situ and occurs prior to progression to invasive disease.
15693887 Data suggest when carcinoma in a gastric biopsy is negative for E-cadherin staining, metastatic breast carcinoma should be considered.
15689490 a novel pathway for Rab11 dependent, dileucine-mediated, mu1B-independent sorting and basolateral trafficking, exemplified by E-cadherin
15689411 These results provide a new example of Rho GTPase regulation of basolateral trafficking and demonstrate novel roles for Cdc42 and Rac1 in the post-Golgi transport of E-cadherin.
15671768 Aberrant E-cadherin is result of point mutation in exon 9 donor splice site causing skipping of exon 9 with consequent deletion of corresponding amino acids. Leads to disturbed cell adhesion. Mediates formation of cadherin/ catenin complex.
15660698 Loss of expression of E-cadherin and beta-catenin may play an important role in the progression of pulmonary adenocarcinoma
15647282 Wnt signaling stabilizes Snail and beta-catenin proteins in tandem fashion so as to cooperatively engage transcriptional programs that control an epithelial-mesenchymal transition.
15638379 Change in the location of E-cadherin expression (from membrane cytoplasm) is strongly associated with an increased aggressiveness of colrectal cancer.
15609397 Observational study of gene-disease association. (HuGE Navigator)
15609397 E-cadherin gene C-160A promoter polymorphism may not play a major role in the etiology of non-cardia gastric cancer in Chinese population.
15609326 heregulin stimulates aggregation and inhibits invasion of MCF-7/6 cells via activation of the E-cadherin/catenin complex
15609307 E-cadherin may have a role in progression of squamous cell carcinoma
15561585 E-cadherin-deficiency in metastatic cancer may in some cases be due to p120 downregulation [review]
15561102 CDHE expression is repressed in the lower crypt of small intestine and is a biological marker of functional relevance.
15542832 the interaction of Pnn with the corepressor CtBP1 may modulate repression of E-cadherin transcription by CtBP1
15509650 conjoint endocytosis and trafficking is a novel mechanism for the coregulation of E-cadherin and FGFR1 during cell signaling and morphogenesis
15500294 The E-Cadherin, the main system of adherens junction, present in the tight junctions in HepG2 cells.
15467754 E-cadherin downregulation is associated with the loss or absence of glandular epithelial differentiation in certain synovial sarcoma
15457549 role in tumor genesis and progress of hereditary gastric carcinoma
15389640 Results point to a functional link between matrix metalloproteinase-3 and E-cadherin
15338868 Laryngeal cancer presented inactivation of Cx43 gene and E-cad gene and down regulation of Cx43 and E-cad proteins.
15330449 T lymphocyte development can proceed independently of alphaEbeta7/E-cadherin interactions
15328195 Decreased E-cadherin expression is an independent prognostic factor for disease progression and mortality in pathological stage I-III endometrial cancer.
15328184 Most invasive and metastatic areas of oral squamous cell carcinoma showed reduced expression and methylation of E-cadherin.
15311212 E-cadherin mutations have no influence on expression of genes involved in Wnt-signaling, but they may promote their own expression by blocking upregulation of E-cadherin repressors.
15308209 Review summarizes divergent studies that provide evidence of the function of E-cadherin trafficking and the puzzle of how this adhesion molecule is regulated and managed throughout the life of the epithelial cell.
15289833 abnormal immunhistochemical E-cadherin and beta-catenin expression is associated with changes in pit pattern in invasive colorectal neoplasms
15285029 E-cadherin and calretinin are sensitive and specific in differential diagnosis of benign and malignant serous effusion specimens.
15274329 Data showed that intestinal metaplasia is associated with E-cadherin down-regulation in gastric mucosa, whereas H. pylori infection does not seem to play a direct role in this process.
15259055 mutant E-cadherin significantly alters the dynamics of cell adhesion and motility in living cells
15254707 E-cadherin and p16INK4a are commonly methylated in non-small cell lung cancer
15254236 the establishment of E-cadherin-based cell-cell adhesion requires Rap1
15251938 Hypermethylation of CDH1 is statistically significantly associated with poor outcome in cervical cancer.
15235021 Thirteen novel CDH1 mutations found in diffuse gastric cancer families.
15231691 Observational study of gene-disease association. (HuGE Navigator)
15231691 E-cadherin -347 G-->GA polymorphism may be associated with colorectal cancer.
15194432 E-cadherin-mediated cell adhesion is required for keratinocyte-mediated control of melanocytic cells, which can override proliferative activity of beta-catenin.
15178462 determination of CDH1 promoter methylation in breast tumors with decreased or absent E-cadherin protein expression
15161659 Cytoplasmic p120ctn may contribute to the invasive phenotype of E-cadherin-deficient breast cancer cells.
15153430 E- to N-cadherin switching in epithelial carcinomas has a potential impact on metastatic progression.
15140023 The absence of dermal invasion of nevus cells could be due to the expression of E-cadherin in these cells in reconstructed epidermis.
15102690 E-cadherin has a role in preventing peritoneal dissemination in gastric cancer
15102685 CDH1 methylation and E-cadherin expression are related and have a role in progression of diffuse gastric cancer
15084762 Observational study of gene-disease association. (HuGE Navigator)
15075377 SH2 and SH3 domains of Src mediate peripheral accumulation of phospho-myosin, leading to integrin adhesion complex assembly, whereas loss of SH2 or SH3 function restores normal regulation of E-cadherin and inhibits vimentin expression
15075229 Snail is involved in both the direct transcriptional repression of genes, such as E-cadherin and occludin, and post-transcriptional events, including downregulation of claudin-1
15033487 E-cadherin-mediated adhesion mechanisms have a role in sperm-oolemma interactions
15024035 Results identify a necessary role for cortactin in the cadherin-actin cooperation that supports productive contact formation.
14998854 promoter hypermethylation and consequent downregulated of E-cadherin is significantly associated with gastric carcinomas of the diffuse histotype
14991757 E-cadherin plays an important role in regulating the invasive potential of prostate cancer cells through an unique paracrine mechanism.
14981918 Combined evaluation of VEGF and E-cadherin levels may become a useful indicator of NSCLC biological behavior and provide clinically important evidence on which to base treatment in NSCLC.
14977637 Cdx1 or Cdx2 expression is sufficient to induce E-cadherin-dependent adhesion of COLO 205 cells associated with polarization and cell-cell membrane compaction, as well as induction of differentiated gene-expression pattern.
14961571 Observational study of gene-disease association. (HuGE Navigator)
14961571 single nucleotide polymorphism in CDH1 is a low-penetrant prostate cancer susceptibility gene
14767510 EphA2 and E-cadherin may play an important role in tumor metastasis in colorectal cancer
14760942 endogenous PGE2 is involved in the hBD-2 and E-cadherin responses of human gingival epithelial cells to A. actinomycetemcomitans. HGEC exposed to A. actinomycetemcomitans showed a decrease in E-cadherin levels.
14750169 Promoter hypermethylation of E-cadherin and its abnormal expression in Epstein-Barr virus-associated gastric carcinoma
14750164 Aberrant methylation of CDH1 is associated with recurrent cervical cancer
14742711 FAM associates with E-cadherin and beta-catenin during trafficking to the plasma membrane
14734465 Low expression of E-cadherin is associated with late cervical metastasis in stage I and II invasive squamous cell carcinoma of the oral tongue
14729585 Observational study of genotype prevalence. (HuGE Navigator)
14729585 investigation of whether the -347G-->GA single nucleotide polymorphism affects the transcriptional activity of the E-cadherin gene
14699157 E-cadherin mediated adhesion and signaling in mammalian epithelial cells requires homolog of disc-large
14695147 an 80 kDa fragment of E-cadherin has a role in the metastatic progression of prostate cancer
14681060 E-cadherin and epidermal growth factor receptor (EGFR) are associated in mammary epithelial cells and that E-cadherin engagement in these cells induces transient activation of EGFR, as previously seen in keratinocytes.
14675278 In human melanocytic tumors, a causative role of (loss of ) E-cadherin or (gain of ) N-cadherin for melanocytic tumor progression still remains to be proven.
14661064 Intragenic deletion of CDH1 is the activating mechanism of the wild-type allele in hereditary diffuse gastric carcinoma.
14637149 We conclude, therefore, that two major components of cell-cell interaction synergistically regulate cell cycle progression in HEK293 cells by regulating p21 expression in a beta-catenin/TCF-dependent manner.
14610318 Observational study of gene-disease association. (HuGE Navigator)
14599963 Pancreatic cancer likely occurs in case of the inactivation of E-cadherin and alpha-catenin genes and abnormal expression of proteins
14585958 A recombinant E-cadherin lacking free sulfhydryl groups and its mutants with novel cysteines were expressed. The coexistence of the structurally identical adhesive and lateral dimers suggests some flexibility of the extracellular cadherin region.
14559984 The frequencies of E-cadherin promoter hypermethylation appear to be correlated with more advanced stage of squamous carcinogenesis in skin.
14559901 the comparable region of N-cadherin can substitute for this required region in E-cadherin and is required for suppression by the mutant form of N-cadherin that is capable of suppressing
14532995 E-cadherin affected the regulation of cell proliferation, differentiation and adhesion, and decreased chemosensitivity
14511406 E-cadherin-mediated cell adhesion and apoptosis of prostatic cancer cells are regulated by ligand activation of the androgen receptor
14507651 Hypoxia induces down-regulation of E-cadherin in ovarian carcinoma cells, via up-regulation of the transcriptional repressor SNAIL.
14501773 Observational study of gene-disease association. (HuGE Navigator)
12949051 E-cadherin has a role in tumorigenicity and metastasis
12937339 provides support that E-cadherin induction by WNT/beta-catenin signaling is an evolutionarily conserved pathway operative in lung cancer cells and that loss of expression may be important in lung cancer development or progression
12923325 Observational study of gene-disease association. (HuGE Navigator)
12923325 the -160 C/A polymorphism of E-cadherin is not directly involved in Korean gastric cancer development
12908778 Observational study of genotype prevalence. (HuGE Navigator)
12903050 Results suggested that human embryos and blastocysts could express E-cadherin and the expression increased during their development.
12890751 Bcl-2 expression decreases the level of functional E-cadherin thereby interfering with junction formation
12875984 Data demonstrate a direct role of E-cadherin/catenin complex organization in the regulation of matrix metalloproteinases and suggest an implication of this regulation in the expression of an invasive phenotype by bronchial tumor cells.
12857907 Expression of HPV16 E6 in keratinocyes decreases expression of cell surface E-cadherin thereby depleting langerhans cells at the site of infection
12851691 Observational study of gene-disease association. (HuGE Navigator)
12851691 Single nucleotide polymorphism in the E-cadherin gene promoter is associated with tumorigenesis and progression of gastric carcinoma
12839684 In nasopharyngeal cancer, methylation of promoter is a major cause of down-regulation of E-cadherin which may finally lead to detachment and metastasis of neoplastic cells.
12824891 Methyl-CpG-binding protein 2 and promoter methylation cooperatively regulate E-cadherin gene expression in colorectal carcinoma
12810698 E-cadherin inhibits human mammary and prostate tumor cell invasion. The invasion suppressor signal is mediated through the beta-catenin-binding domain of the E-cadherin cytoplasmic tail.
12800196 CDH1 inactivation due to mutations, LOH and methylation is associated with invasive and in situ lobular breast cancer.
12797865 Findings document the differential expression, subcellular localization and cell-cycle-regulatory activity of alternatively spliced human CDH1 isoforms.
12786894 The loss of E-cadherin rather than beta-catenin mutation is the crucial event in determining the differentiation 'level' of thyroid carcinomas
12767511 Observational study of gene-disease association. (HuGE Navigator)
12767511 E-cadherin A/A genotype may be associated with susceptibility to urothelial cancer, but not with the progression of disease.
12759241 Findings identify E-cadherin as a novel substrate for matrilysin and indicate that shedding of E-cadherin ectodomain is required for epithelial repair.
12740491 Observational study of gene-disease association. (HuGE Navigator)
12740491 polymorphism of CDH-1 3'-UTR is a valid genetic marker for calcium stone disease.
12725331 dedifferentiation and a decreased expression of E-cadherin and ZO-1 are closely related to liver metastasis
12712492 High expression of E-cadherin is associated with the development of lymphatic tumor emboli
12694354 Abnormal expression of E-cadherin was seen in mucoepidermoid carcinoma.
12672818 The molecular requirements for E-cadherin to activate Rac signaling thus appear distinct from those that stimulate PI3-kinase, and we postulate that p120-ctn may play a central role in the E-cadherin-Rac signaling pathway.
12668723 E-cadherin and claudins/occludin have roles in the regulation of tight junctions during the epithelium-mesenchyme transition, but are repressed by snail
12665652 decreased expression of the E-cadherin catenin complex and methylation of the E-cadherin gene promoter region was found only in growth hormone cell adenomas with prominent fibrous bodies
12657640 possibility that multiple pathways exist for E-cadherin entry into cells that are likely to reflect cell context and regulation.
12647217 study verified reduced expressions of adenomatous polyposis coli and E-cadherin proteins in colorectal cancer cells and suggests that normal protein expressions in benign epithelium are progressively and independently lost in sporadic colorectal cancers
12629411 Hypermethylation of an E-cadherin (CDH1) promoter region in high grade transitional cell carcinoma of the bladder comprising carcinoma in situ.
12606944 Pulse-labeled beta-catenin replaces the beta-catenin bound to the cell surface prebiotinylated E-cadherin immediately after synthesis or arrives at the plasma membrane in a complex with the E-cadherin precursor.
12588804 Observational study of genotype prevalence. (HuGE Navigator)
12587534 matrix metalloproteinase-2 and 9 and membrane-type 1 matrix metalloproteinase mRNA expression in endometriosis was higher than in normal endometrium whereas E-cadherin, alpha- and beta-catenin mRNA expression was not suppressed in endometriosis
12579297 CpG methylation and thus loss of E-cadherin is associated with metastasising laryngeal cancer.
12560341 phosphorylation-dependent localization of CDH1 in vertebrate cells.
12532469 Abnormal E-cadherin and alpha-catenin and beta-catenin in pancreatic carcinoma tissues. Abnormal E-cadherin and alpha-catenin with differentiation, lymph node and liver metastases. Aberrant beta-catenin with lymph node and liver metastases.
12532436 Expression of e-cadherin and beta-catenin in human esophageal squamous cell carcinoma: relationships with prognosis.
12532420 The presence of E-cadherin mutations can significantly alter the accumulation of the apoptosis-regulating p53 protein, whereas no correlation with the p53 mutation status or with Ki-67 staining was observed.
12532418 Loss of E-cadherin expression followed by expression of the mts1 gene may be an important event for increasing cell proliferation, motility and invasion activity in the progression of gallbladder cancer.
12517779 promotion of E-cadherin and suppression of beta-catenin/T cell factor may be an important mechanism underlying the chemopreventive action of Ca(2+) in colon cancer
12511569 role in negative regulation of CD44-hyaluronan interaction
12481018 The reduction of E-cadherin and beta-catenin expression was related to invasiveness and proliferative status of prolactinomas and correlated with the more aggressive behavior of prolactinomas in men compared with in women.
12452045 clinical significance of E-cadherin and proliferating cell nuclear antigen expression in adenoid cystic carcinoma
12444556 Observational study of gene-disease association. (HuGE Navigator)
12444556 association of CDH1 haplotypes with susceptibility to sporadic diffuse gastric cancer
12427869 These data reveal a cooperative interaction between p120 catenin and E-cadherin and a novel role for p120 that is likely indispensable in normal cells.
12414996 Involvement of the adhesive ligand pair CD103-E-cadherin in human thymocyte cell proliferation
12409468 in vivo evidence in cancer cells of the differential association between CpG methylation, MBPs, and histone modification in the entire CpG island of the human E-cadherin (CDH1) gene
12398810 results indicate that expression of E-cadherin in IST-1 trophoblast cells results in a contact-mediated inhibition of motility and invasion and suggest an important role for E-cadherin down-regulation in the intermediate trophoblast during implantation
12397640 E-cadherin is hypermethylated and shows low expression in colon and rectal neoplasms
12393869 investigates whether E-cadherin is a substrate for calpain and whether calpain-dependent proteolysis was associated with prostate cancer progression
12391156 In vivo recruitment of RB and AP-2 proteins on the E-cadherin promoter in MCF7 cells
12370292 dimerization of E-cadherin is important for its cell adhesive properties
12219004 Restoration of E-cadherin/beta-catenin expression in pancreatic cancer cells inhibits growth by induction of apoptosis.
12216071 germline E-cadherin mutations responsible for the predisposition to diffuse gastric cancer (DGC) among the Japanese
12209998 Observational study of gene-disease association. (HuGE Navigator)
12209998 CDH1 c-160a promotor polymorphism is not associated with risk of stomach cancer.
12209606 Observational study of gene-disease association. (HuGE Navigator)
12209606 E-cadherin polymorphism in prostate neoplasms
12203775 E-cadherin promoter is subject to epigenetic control in colorectal ulceration and plays a role in the progression from chronic inflammation to colorectal cancer.
12203370 CpG hypermethylation was an important mechanism of E-cadherin gene inactivation in bladder cancer and also that specific CpG sites consistently presented higher methylation levels than others.
12198663 Altered expression of E-cadherin in hepatocellular carcinoma
12189238 Downregulation of E-cadherin in melanocytes and melanoma cells by endothelin-1
12169098 oxidative stress induces tyrosine phosphorylation and cellular redistribution of occludin-ZO-1 and E-cadherin-beta-catenin complexes by a tyrosine-kinase-dependent mechanism
12161443 ZEB1 plays a role in repressing E-cadherin and MUC1 in epithelial cells [ZEB-1]
12140137 Defected E-cadherin expression might play a role in the development of malignant phenotype in NSCLC
12138162 Data suggest that E-cadherin-mediated signaling through PI3-kinase can regulate the invasive behavior of cells by modulating proteinase secretion.
12134161 Src-induced disruption of E-cadherin localization requires specific integrin signalling.
12127160 aberrant methylation preferentially occurs in invasive ductal breast cancer associated with poor prognosis and is one of the mechanisms of expression silence in breast cancers
12115723 Recovery of cellular E-cadherin precedes replenishment of estrogen receptor and estrogen-dependent proliferation of breast cancer cells rescued from a death stimulus.
12095414 role in regulating expression of the leucocyte common antigen-related tyrosine phosphatase
12082610 promoter methylation studied in 80 patients with head and neck squamous cell carcinoma (HNSCC)
12061792 CAS/CSE 1 stimulates E-cadhrin-dependent cell polarity in HT-29 human colon epithelial cells.
12057916 E-cadherin expression in dental epithelium followed an apical-coronal gradient that was opposite to that observed for N-cadherin.
12049819 Differential expression in human brain tumors
12037667 restoration of cell adhesion by overexpression of nectin in HSC-39 cells
12036913 Observational study of gene-disease association. (HuGE Navigator)
12027444 Tumor-associated mutations of E-cadherin enhanced random cell movement of transfected MDA-MB-435S mammary carcinoma cells as compared to wild-type (wt) E-cadherin-expressing cells.
12021924 mucoepidermoid carcinoma of the thyroid (MECT)displays consistent neoexpression of P-cadherin and major alterations in the expression of E-cadherin and the three catenins
11996968 characterization of DNA polymorphism in promoter regions
11948460 Observational study of gene-disease association. (HuGE Navigator)
11937138 results suggest that the inadequate trophoblastic invasion, induced by antiphospholipid antibodies, can be the result of decreased alpha1 integrin and VE-cadherin and increased alpha5 integrin and E-cadherin expression in the trophoblast
11920500 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11916976 Lateral dimerization of the E-cadherin extracellular domain is necessary but not sufficient for adhesive activity
11912130 The SLUG zinc-finger protein represses E-cadherin in breast cancer.
11896626 Observational study of gene-disease association. (HuGE Navigator)
11870667 E-cadherin play important roles in esophageal carcinogenesis.
11861761 These results demonstrate that integrin-dependent cell to extracellular matrix adhesion reinforces E-cadherin-dependent cell-cell adhesion in Caco-2 cells.
11857408 Observational study of gene-disease association. (HuGE Navigator)
11856755 biological function of Cys(9) within the first repeat (the E-cadherin-derived N-terminal repeat)
11846558 D257A & D370A mutations result in abnormal protein localization, changes in the actin cytoskeleton, reduced homophilic cell adhesion, and altered cell morphology; tumor-associated D370A mutation, but not the D257A mutation, induced increased cell motility
11839665 distinct methylation pattern in bladder cancer with frequent methylation of RARbeta, DAPK, E-cadherin, and p16.
11813884 E-cadherin might be used as additional cell markers of Schwann cell-derived tumors.
11801604 restoration of E-cadherin dependent adhsion in human protate carcinoma cells by expression of receptor protein-tyrosine phosphatase, PTPmu
11790800 Cadherin-mediated cell sorting not determined by binding or adhesion specificity
11747475 Loss of E-cadherin may result in the disruption of the function of the cell-cell adhesion complex, which may cause weak cell-cell adhesion and confer invasive properties on a tumor.
11733362 The E-cadherin gene was potentially inactivated in a significant number of synovial sarcomas.
11705864 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11705864 Mutations and polymorphisms in E-cadherin gene CDH1, such as S270A, may contribute to the onset of prostate cancer (PCA) and warrant further investigations in other populations.
11683173 Both expression of E-cadherin and its membranous localization are required for well-differentiated-type morphogenesis in gallbladder cancer cells.
11158177 Observational study of gene-disease association. (HuGE Navigator)
10713718 HIV-1 Tat C treated human brain microvascular endothelial cells result in downregulation and dissociation of VE-PTP and SHP2 from VE-cadherin
10523846 Products of the c-myc gene activate or repress the activity of the E-cadherin promoter
9632747 Human RB and c-Myc activate expression of the murine E-cadherin gene in epithelial cells through interaction with transcription factor AP-2
3263290 cell adhesion

AA Sequence

MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFS      1 - 70
LDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELL     71 - 140
TFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERE    141 - 210
TGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTS    211 - 280
VMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADL    281 - 350
QGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG    351 - 420
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPE    421 - 490
KRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNST    491 - 560
YTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAEL    561 - 630
THGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQP    631 - 700
VEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLS    701 - 770
QLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS    771 - 840
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD                                841 - 882
//

Text Mined References (1488)

PMID Year Title
27273957 E-cadherin/?-catenin deregulated co-expression in thyroid carcinoma based on tissue microarray digital image analysis.
27067410 2016 The association between CDH1 promoter methylation and patients with ovarian cancer: a systematic meta-analysis.
27048119 2016 Role of TWIST2, E-cadherin and Vimentin in epithelial ovarian carcinogenesis and prognosis and their interaction in cancer progression.
26927545 2016 [miR-101 inhibits the proliferation and migration of breast cancer cells via downregulating the expression of DNA methyltransferase 3a].
26927375 2016 [Grape seed proanthocyanidins inhibits the invasion and migration of A549 lung cancer cells].
26901067 2016 Frequent somatic CDH1 loss-of-function mutations in plasmacytoid variant bladder cancer.
26897964 2015 EZH2 Mediates the Regulation of S100A4 on E-cadherin Expression and the Proliferation, Migration of Gastric Cancer Cells.
26855131 2016 The utility of tetraspanin CD9 as a biomarker for metastatic clear cell renal cell carcinoma.
26847082 2016 Establishment and characterization of a metastasis model of human gastric cancer in nude mice.
26842802 2016 HIF-2? promotes epithelial-mesenchymal transition through regulating Twist2 binding to the promoter of E-cadherin in pancreatic cancer.
26819089 2016 Epigenetic regulation of E-cadherin expression by the histone demethylase UTX in colon cancer cells.
26810856 2016 Aspirin inhibits epithelial-to-mesenchymal transition and migration of oncogenic K-ras-expressing non-small cell lung carcinoma cells by down-regulating E-cadherin repressor Slug.
26758745 2016 Prognostic value of high FoxC2 expression in resectable non-small cell lung cancer, alone or in combination with E-cadherin expression.
26757261 2016 E-Cadherin fragments as potential mediators for peritoneal metastasis in advanced epithelial ovarian cancer.
26746659 2016 Paradoxical E-cadherin increase in 5FU-resistant colon cancer is unaffected during mesenchymal-epithelial reversion induced by ?-secretase inhibition.
26742007 2016 Loss of CDH1 (E-cadherin) expression is associated with infiltrative tumour growth and lymph node metastasis.
26724145 2016 Differential membranous E-cadherin expression, cell proliferation and O-GlcNAcylation between primary and metastatic nodal lesion in colorectal cancer.
26708505 2016