Property Summary

NCBI Gene PubMed Count 40
PubMed Score 36.41
PubTator Score 51.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (18)

PMID Text
26170459 enhanced CDCA8 promoter activities by NF-Y overexpression and reduced CDCA8 transcription by NF-Y knockdown further verified that NF-Y is a positive regulator of CDCA8 transcription.
25854549 Borealin dimerization mediates chromosomal passenger complex checkpoint function by enhancing localization to centromeres and kinetochores.
25260804 In colorectal cancer patients, Borealin expression was positively correlated with age, lymph node metastasis and neoplasm staging.
24917673 These findings reveal a previously unrecognized but direct link between HP1 and CPC localization in the centromere and illustrate the critical role of borealin-HP1 interaction in orchestrating an accurate cell division.
22797924 MLL5 functionally interacts with Borealin, facilitates the expression of chromosomal passenger complex, and hence contributes to mitotic fidelity and genomic integrity.
22724069 Borealin interacts directly with the Snf7 components of ESCRT-III in human cells.the Borealin central region encompassing residues 110-207 was both necessary & sufficient to bind to CHMP4C.
20803554 important role for phosphorylation of Borealin at S219 in the proper progression through mitosis
19530738 found that substitutions at Borealin T230, recently identified as an Mps1 phosphorylation site, can modulate the dimerization state of Borealin
18946085 Data describe a mitotic SUMO2/3 conjugation-deconjugation cycle of Borealin and further assign a regulatory function of RanBP2 and SENP3 in the mitotic SUMO pathway.
18311593 Borealin plays a crucial role in the early mouse embryonic development
17956729 Borealin and INCENP associate with the helical domain of Survivin to form a tight three-helical bundle.
17881355 mitotic regulator Survivin binds as a monomer to its functional interactor Borealin
17716930 It is recorded that borealin is a cell cycle regulator, down-regulated in response to p53/Rb-signaling, and up-regulated in many types of cancerous tissues.
17483322 Suppression of CDCA8 expression with small interfering RNA against CDCA8 significantly suppressed the growth of lung cancer cells.
17241471 Borealin is phosphorylated during mitosis. Neither residue S165, T106 nor phosphorylation of borealin by Aurora B Kinase is required to generate the mitotic, shifted form of Borealin.
16571674 A functional module within the chromosomal passenger complex involving the inner centromere protein INCENP, Survivin, and Borealin.
16427043 Cell cycle-regulated chromosomal passenger protein whose aberrant expression and nuclear accumulation are linked to poor prognosis for gastric cancer.
16239925 Data show that INCENP has an important role in stabilizing the chromosomal passenger complex, and that Borealin acts to promote binding of Survivin to INCENP.

AA Sequence

MAPRKGSSRVAKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILRLPKALREMNW      1 - 70
LDYFALGGNKQALEEAATADLDITEINKLTAEAIQTPLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTA     71 - 140
RVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSRVFKTPGLRTPAAGER    141 - 210
IYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK    211 - 280
//

Text Mined References (48)

PMID Year Title
26170459 2015 Transcriptional activation of human CDCA8 gene regulated by transcription factor NF-Y in embryonic stem cells and cancer cells.
25854549 2015 Borealin dimerization mediates optimal CPC checkpoint function by enhancing localization to centromeres and kinetochores.
25416956 2014 A proteome-scale map of the human interactome network.
25260804 2014 Borealin/Dasra B is overexpressed in colorectal cancers and contributes to proliferation of cancer cells.
24917673 2014 Chromatin protein HP1 interacts with the mitotic regulator borealin protein and specifies the centromere localization of the chromosomal passenger complex.
24571573 2014 The GAR domain of GAS2L3 mediates binding to the chromosomal passenger complex and is required for localization of GAS2L3 to the constriction zone during abscission.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797924 2012 MLL5 maintains genomic integrity by regulating the stability of the chromosomal passenger complex through a functional interaction with Borealin.
22724069 2012 The chromosomal passenger complex controls the function of endosomal sorting complex required for transport-III Snf7 proteins during cytokinesis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21051298 2011 Spatio-temporal composition of the mitotic Chromosomal Passenger Complex detected using in situ proximity ligation assay.
20803554 2010 Regulation of Borealin by phosphorylation at serine 219.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19530738 2009 Phosphorylation of a borealin dimerization domain is required for proper chromosome segregation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18946085 2009 RanBP2 and SENP3 function in a mitotic SUMO2/3 conjugation-deconjugation cycle on Borealin.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18591255 2008 A survivin-ran complex regulates spindle formation in tumor cells.
18311593 2009 Borealin is differentially expressed in ES cells and is essential for the early development of embryonic cells.
18243099 2008 Mps1 phosphorylates Borealin to control Aurora B activity and chromosome alignment.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17956729 2007 Structure of a Survivin-Borealin-INCENP core complex reveals how chromosomal passengers travel together.
17881355 2007 The mitotic regulator Survivin binds as a monomer to its functional interactor Borealin.
17716930 2007 Borealin is repressed in response to p53/Rb signaling.
17483322 2007 Phosphorylation and activation of cell division cycle associated 8 by aurora kinase B plays a significant role in human lung carcinogenesis.
17241471 2007 Analysis of mitotic phosphorylation of borealin.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17099693 2006 The Survivin-Crm1 interaction is essential for chromosomal passenger complex localization and function.
16571674 2006 Centromere targeting of the chromosomal passenger complex requires a ternary subcomplex of Borealin, Survivin, and the N-terminal domain of INCENP.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16547492 2006 Subcellular localization and nucleocytoplasmic transport of the chromosomal passenger proteins before nuclear envelope breakdown.
16436504 2006 Uncoupling the central spindle-associated function of the chromosomal passenger complex from its role at centromeres.
16427043 2006 Borealin/Dasra B is a cell cycle-regulated chromosomal passenger protein and its nuclear accumulation is linked to poor prognosis for human gastric cancer.
16291752 2006 Molecular analysis of survivin isoforms: evidence that alternatively spliced variants do not play a role in mitosis.
16239925 2006 Survivin mediates targeting of the chromosomal passenger complex to the centromere and midbody.
15635413 2005 Nucleolar proteome dynamics.
15561729 2005 Proteome analysis of the human mitotic spindle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15260989 2004 The chromosomal passenger complex is required for chromatin-induced microtubule stabilization and spindle assembly.
15249581 2004 Borealin: a novel chromosomal passenger required for stability of the bipolar mitotic spindle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12188893 2001 Drug target discovery by gene expression analysis: cell cycle genes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.