Property Summary

NCBI Gene PubMed Count 25
PubMed Score 10.51
PubTator Score 20.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 1.400 2.8e-08
glioblastoma multiforme 2.500 1.2e-21
oligodendroglioma 1.800 2.9e-10
osteosarcoma -2.971 6.4e-04
ependymoma 1.200 8.1e-04
sonic hedgehog group medulloblastoma 2.200 1.9e-07
atypical teratoid / rhabdoid tumor 1.800 2.1e-03
medulloblastoma, large-cell 2.400 1.6e-05
primitive neuroectodermal tumor 1.400 8.6e-04
adrenocortical carcinoma 1.303 5.7e-03
primary pancreatic ductal adenocarcinoma -1.199 8.3e-03
tuberculosis and treatment for 3 months 1.300 5.8e-04
adult high grade glioma 2.500 1.3e-05
pilocytic astrocytoma 2.100 1.6e-07
Breast cancer -1.500 1.4e-04
lung carcinoma -2.200 1.9e-26
ovarian cancer -1.700 7.1e-06
pancreatic cancer -1.100 1.7e-02

Gene RIF (13)

PMID Text
26245978 common LEDGF/p75 interaction interface shared by JPO2, PogZ, MLL1, IWS1 and HIV IN
26245978 Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells
25480495 The data are consistent with the rs4487645-CDCA7L loci being responsible for the chromosome 7p11.2 association with multiple myeloma risk, probably exerting its effects through an extended pathway involving IRF4 and MYC.
24634210 Data indicate that JPO2 and LEDGF/p75 interact directly and specifically in vivo through the specific interaction domain of JPO2 and the C-terminal domain of LEDGF/p75.
24634210 Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells
24141559 CDCA7L was able to activate the extracellular signal-regulated kinase 1/2 (ERK1/2) signaling pathway and regulate the cell cycle, thus promoting HCC progression.
23898208 Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells
21654740 Reduction in R1 repressor protein correlates significantly with an increase (approximately 40%) in monoamine oxidase A protein levels within the major depressive disorder groups compared with controls.
18789977 Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells
17669426 Over-expression of JPO2 resulted in a modest but reproducible inhibition of HIV-1 replication, consistent with competition between integrase and JPO2 for binding to LEDGF/p75
17669426 Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells
16829576 demonstrates the functions of MAO A and its repressor R1(RAM2/CDCA7L/JPO2) in apoptotic signaling pathways
16728402 monoamine oxidase A activation of glucocorticoids and androgens is regulated differently by R1 and Sp1

AA Sequence

MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDVRFHSKYFTEELR      1 - 70
RIFIEDTDSETEDFAGFTQSDLNGKTNPEVMVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSI     71 - 140
GLRVAFQFPTKKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESEDDSRDESQES    141 - 210
SDALLKRTMNIKENKAMLAQLLAELNSMPDFFPVRTPTSASRKKTVRRAFSEGQITRRMNPTRSARPPEK    211 - 280
FALENFTVSAAKFAEEFYSFRRRKTIGGKCREYRRRHRISSFRPVEDITEEDLENVAITVRDKIYDKVLG    281 - 350
NTCHQCRQKTIDTKTVCRNQGCCGVRGQFCGPCLRNRYGEDVRSALLDPDWVCPPCRGICNCSYCRKRDG    351 - 420
RCATGILIHLAKFYGYDNVKEYLESLQKELVEDN                                        421 - 454
//

Text Mined References (32)

PMID Year Title
26245978 2015 Multiple cellular proteins interact with LEDGF/p75 through a conserved unstructured consensus motif.
25480495 2015 The 7p15.3 (rs4487645) association for multiple myeloma shows strong allele-specific regulation of the MYC-interacting gene CDCA7L in malignant plasma cells.
25416956 2014 A proteome-scale map of the human interactome network.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24634210 2014 Dynamics of the ternary complex formed by c-Myc interactor JPO2, transcriptional co-activator LEDGF/p75, and chromatin.
24141559 2013 CDCA7L promotes hepatocellular carcinoma progression by regulating the cell cycle.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21654740 2011 The reduction of R1, a novel repressor protein for monoamine oxidase A, in major depressive disorder.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17669426 2007 Differential interaction of HIV-1 integrase and JPO2 with the C terminus of LEDGF/p75.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16829576 2006 Monoamine oxidase A and repressor R1 are involved in apoptotic signaling pathway.
16735438 2006 Transcriptional co-activator p75 binds and tethers the Myc-interacting protein JPO2 to chromatin.
16728402 2006 Glucocorticoid and androgen activation of monoamine oxidase A is regulated differently by R1 and Sp1.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15994933 2005 Identification of a novel c-Myc protein interactor, JPO2, with transforming activity in medulloblastoma cells.
15654081 2005 R1, a novel repressor of the human monoamine oxidase A.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.