Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.37
PubTator Score 11.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (26)

Gene RIF (6)

AA Sequence

MDARRVPQKDLRVKKNLKKFRYVKLISMETSSSSDDSCDSFASDNFANTRLQSVREGCRTRSQCRHSGPL      1 - 70
RVAMKFPARSTRGATNKKAESRQPSENSVTDSNSDSEDESGMNFLEKRALNIKQNKAMLAKLMSELESFP     71 - 140
GSFRGRHPLPGSDSQSRRPRRRTFPGVASRRNPERRARPLTRSRSRILGSLDALPMEEEEEEDKYMLVRK    141 - 210
RKTVDGYMNEDDLPRSRRSRSSVTLPHIIRPVEEITEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDT    211 - 280
KTNCRNPDCWGVRGQFCGPCLRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKY    281 - 350
HGFGNVHAYLKSLKQEFEMQA                                                     351 - 371
//

Text Mined References (23)

PMID Year Title