Property Summary

NCBI Gene PubMed Count 25
PubMed Score 25.26
PubTator Score 18.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -1.465 1.4e-02
glioblastoma 1.600 2.5e-07
group 3 medulloblastoma 2.400 8.5e-05
atypical teratoid/rhabdoid tumor 1.500 9.7e-08
medulloblastoma, large-cell 2.100 2.8e-05
primitive neuroectodermal tumor 1.500 2.0e-03
Atopic dermatitis 1.100 1.2e-04
adrenocortical carcinoma 1.812 5.8e-04
pancreatic ductal adenocarcinoma liver m... 1.012 3.8e-02
non-small cell lung cancer 2.559 2.0e-29
intraductal papillary-mucinous neoplasm ... 1.500 2.0e-03
breast carcinoma 1.400 8.7e-05
pediatric high grade glioma 1.500 8.6e-05
psoriasis 1.500 3.2e-105
lung adenocarcinoma 2.400 5.6e-10
inflammatory breast cancer 2.600 6.7e-06
ductal carcinoma in situ 1.400 1.9e-03
invasive ductal carcinoma 1.900 2.0e-04
ovarian cancer 1.900 8.2e-09

 GO Function (1)

Gene RIF (12)

PMID Text
26177583 phosphorylation plays unexpected roles in regulating the subcellular localization of Sororin.
25608232 the C-terminus of Sororin functions as an anchor binding to SA2, which facilitates other conserved motifs on Sororin to interact with other proteins to regulate sister chromatid cohesion and separation.
25257309 A transcriptome-wide analysis revealed that SNW1 or PRPF8 depletion affects the splicing of specific introns in a subset of pre-mRNAs, including pre-mRNAs encoding the cohesion protein sororin and the APC/C subunit APC2.
25092791 We propose that the Prp19 complex and the splicing machinery contribute to the establishment of cohesion by promoting Sororin accumulation during S phase, and are, therefore, essential to the maintenance of genome stability.
24098701 Targeting p35/Cdk5 signalling via CIP-peptide promotes angiogenesis in hypoxia.
22833568 Data show that the MEK-ERK pathway regulates cell cycle-related neuronal apoptosis (CRNA) by elevating the levels of cyclin D1, and the increase in cyclin D1 attenuates the activation of cyclin-dependent kinase 5 (cdk5) by its neuronal activator p35.
21987589 Sororin is phosphorylated by Cdk1/cyclin B at prophase and acts as a docking protein to bring Plk1 into proximity with SA2, resulting in the phosphorylation of SA2 and the removal of cohesin complexes from chromosomal arms.
21115494 the interaction of the highly conserved motif at the C terminus of sororin with the cohesin complex is critical to its ability to mediate sister chromatid cohesion.
20551060 Transactivation of CDCA5 and its phosphorylation at Ser209 by ERK play an important role in lung cancer proliferation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17361102 Sororin protects centromeric cohesion in response to the spindle checkpoint, but prevents the removal of cohesion by a mechanism independent of the anaphase-promoting complex.
17349791 data indicate that sororin interacts with chromatin-bound cohesin and functions during the establishment or maintenance of cohesion in S or G2 phase, respectively

AA Sequence

MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEV      1 - 70
PAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSK     71 - 140
KVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISP    141 - 210
PPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE                                211 - 252
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26177583 2016 Multiple Levels of Regulation of Sororin by Cdk1 and Aurora B.
25608232 2015 C-terminus of Sororin interacts with SA2 and regulates sister chromatid cohesion.
25257309 2014 SNW1 enables sister chromatid cohesion by mediating the splicing of sororin and APC2 pre-mRNAs.
25092791 2014 Sororin pre-mRNA splicing is required for proper sister chromatid cohesion in human cells.
24098701 2013 Targeting p35/Cdk5 signalling via CIP-peptide promotes angiogenesis in hypoxia.
23548868 2013 ASURA (PHB2) interacts with Scc1 through chromatin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22833568 2012 Interplay between MEK-ERK signaling, cyclin D1, and cyclin-dependent kinase 5 regulates cell cycle reentry and apoptosis of neurons.
21987589 2011 Interaction of Sororin protein with polo-like kinase 1 mediates resolution of chromosomal arm cohesion.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21115494 2011 A conserved motif at the C terminus of sororin is required for sister chromatid cohesion.
21111234 2010 Sororin mediates sister chromatid cohesion by antagonizing Wapl.
20551060 2010 Phosphorylation and activation of cell division cycle associated 5 by mitogen-activated protein kinase play a crucial role in human lung carcinogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17361102 2007 Regulation of centromeric cohesion by sororin independently of the APC/C.
17349791 2007 Sororin is required for stable binding of cohesin to chromatin and for sister chromatid cohesion in interphase.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15837422 2005 Sororin, a substrate of the anaphase-promoting complex, is required for sister chromatid cohesion in vertebrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12188893 2001 Drug target discovery by gene expression analysis: cell cycle genes.
11111111 2000 Epidemiology of the antibiotic resistance of Helicobacter pylori in Canada.