Property Summary

NCBI Gene PubMed Count 12
PubMed Score 13.98
PubTator Score 65.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.529 1.4e-06
adult high grade glioma 1.100 1.2e-03
atypical teratoid / rhabdoid tumor 2.400 1.8e-11
ependymoma 1.100 4.8e-08
glioblastoma 1.200 5.2e-07
group 3 medulloblastoma 1.900 2.2e-05
invasive ductal carcinoma 1.200 1.1e-03
lung cancer 2.100 4.6e-05
medulloblastoma, large-cell 2.800 3.8e-07
non-small cell lung cancer 1.605 3.6e-19
osteosarcoma -1.873 2.1e-04
primitive neuroectodermal tumor 2.100 9.5e-07

Synonym

Accession Q9BXL8 Q8TB18 Q9NWK7
Symbols HEPP
SEI-3/HEPP

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (5)

AA Sequence

MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQ      1 - 70
EEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAWGQEGAHPAPGLGDGHTQGPVSDLCPVTSAQAPRH     71 - 140
LQSSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLDTVLTGMMGGARPGPCEGL    141 - 210
EGLAPATPGPSSSCKSDLGELDHVVEILVET                                           211 - 241
//

Text Mined References (12)

PMID Year Title