Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.68
PubTator Score 7.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma 1.200 2.2e-06
osteosarcoma -1.280 3.9e-02
posterior fossa group A ependymoma 1.400 6.0e-06
glioblastoma 2.100 1.8e-10
sonic hedgehog group medulloblastoma 2.700 3.8e-09
atypical teratoid/rhabdoid tumor 2.300 1.5e-11
medulloblastoma, large-cell 2.000 1.4e-05
primitive neuroectodermal tumor 2.100 5.5e-06
Atopic dermatitis 1.500 2.4e-04
adrenocortical carcinoma 1.584 1.6e-03
non-small cell lung cancer 2.633 1.3e-29
intraductal papillary-mucinous carcinoma... 2.500 6.6e-05
intraductal papillary-mucinous neoplasm ... 3.200 2.7e-04
lung cancer 1.800 4.1e-05
pancreatic cancer 1.200 1.1e-03
pediatric high grade glioma 2.100 2.9e-07
lung adenocarcinoma 1.200 3.9e-11
Endometriosis 1.223 1.1e-02
Breast cancer 2.600 3.7e-18
breast carcinoma 1.200 2.3e-30
ductal carcinoma in situ 1.400 5.5e-03
invasive ductal carcinoma 1.900 1.3e-04
ovarian cancer 2.500 2.6e-07
psoriasis 1.200 2.2e-61

Gene RIF (6)

PMID Text
25673160 OY-TES-1 downregulation in liver cancer cells promotes cell proliferation by upregulating CCND2 and CDCA3.
25236463 High CDCA3 expression is associated with neoplasms.
23219899 HoxB3 promote prostate cancer progression by upregulating CDCA3 expression.
22839099 overexpression of CDCA3 occurs frequently during oral carcinogenesis.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15733861 a repressor element (cell-cycle-dependent element/cell cycle gene homology region) in the vicinity of the transcription start site, and mutations within this element diminished the cell-cycle-dependent transcriptional regulation of Tome-1

AA Sequence

MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKHAQDSDPRSPT      1 - 70
LGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSSELDLPLGTQLSVEEQMPPWN     71 - 140
QTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSP    141 - 210
GTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES                211 - 268
//

Text Mined References (24)

PMID Year Title
25673160 2015 OY-TES-1 may regulate the malignant behavior of liver cancer via NANOG, CD9, CCND2 and CDCA3: a bioinformatic analysis combine with RNAi and oligonucleotide microarray.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25236463 2015 Translating bioinformatics in oncology: guilt-by-profiling analysis and identification of KIF18B and CDCA3 as novel driver genes in carcinogenesis.
23219899 2013 HoxB3 promotes prostate cancer cell progression by transactivating CDCA3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22839099 2012 Overexpression of cell cycle regulator CDCA3 promotes oral cancer progression by enhancing cell proliferation with prevention of G1 phase arrest.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15733861 2005 Cell-cycle-dependent regulation of the human and mouse Tome-1 promoters.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12679038 2003 Tome-1, a trigger of mitotic entry, is degraded during G1 via the APC.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12188893 2001 Drug target discovery by gene expression analysis: cell cycle genes.
9074930 1997 Large-scale sequencing in human chromosome 12p13: experimental and computational gene structure determination.
8723724 1996 A gene-rich cluster between the CD4 and triosephosphate isomerase genes at human chromosome 12p13.