Property Summary

Ligand Count 155
NCBI Gene PubMed Count 65
PubMed Score 184.69
PubTator Score 90.95

Knowledge Summary

Patent (13,132)

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.698 4.1e-03
Atopic dermatitis 1.400 1.1e-05
Breast cancer 4.800 2.7e-02
breast carcinoma 1.200 8.6e-21
ductal carcinoma in situ 1.700 6.7e-04
Endometriosis 1.417 3.1e-02
group 3 medulloblastoma 1.300 1.3e-02
interstitial cystitis 1.200 5.6e-03
intraductal papillary-mucinous carcinoma... 1.700 7.9e-03
intraductal papillary-mucinous neoplasm ... 2.000 9.7e-03
invasive ductal carcinoma 1.800 2.4e-02
lung cancer 1.700 2.8e-02
malignant mesothelioma 1.800 1.0e-07
nasopharyngeal carcinoma 1.200 1.2e-04
non-small cell lung cancer 1.015 3.5e-09
osteosarcoma -1.510 5.0e-02
ovarian cancer 1.200 2.0e-02
Rheumatoid arthritis 1.200 4.6e-02

Gene RIF (42)

AA Sequence

MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKIEDKIGEGTFS      1 - 70
SVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHE     71 - 140
SFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTHDTKIEL    141 - 210
LKFVQSEAQQERCSQNKSHIITGNKIPLSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGL    211 - 280
SVQRSVFGERNFNIHSSISHESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLT    281 - 350
CDCYATDKVCSICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD    351 - 420
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQGHASHQPAIS    421 - 490
EKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPDEAYDLLDKLLDLNPASRITA    491 - 560
EEALLHPFFKDMSL                                                            561 - 574
//

Text Mined References (70)

PMID Year Title