Property Summary

NCBI Gene PubMed Count 61
PubMed Score 175.08
PubTator Score 90.95

Knowledge Summary

Patent (13,132)

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.200 4.6e-02
malignant mesothelioma 1.800 1.0e-07
osteosarcoma -1.510 5.0e-02
Atopic dermatitis 1.400 1.1e-05
adrenocortical carcinoma 1.698 4.1e-03
non-small cell lung cancer 1.015 3.5e-09
intraductal papillary-mucinous carcinoma... 1.700 7.9e-03
intraductal papillary-mucinous neoplasm ... 2.000 9.7e-03
lung cancer 1.700 2.8e-02
Breast cancer 4.800 2.7e-02
interstitial cystitis 1.400 9.7e-04
group 3 medulloblastoma 1.300 1.3e-02
nasopharyngeal carcinoma 1.200 1.2e-04
Endometriosis 1.417 3.1e-02
breast carcinoma 1.200 8.6e-21
ductal carcinoma in situ 1.700 6.7e-04
invasive ductal carcinoma 1.800 2.4e-02
ovarian cancer 1.600 7.2e-04

Gene RIF (39)

PMID Text
26383992 The presence of the index SNP rs1192415 (TGFBR3-CDC7) was associated with visual field progression in POAG (primary open-angle glaucoma) patients.
26208856 Our data show that Cdc7 is highly expressed in colorectal cancer
25258324 The state of DUE-B phosphorylation is maintained by the equilibrium between Cdc7-dependent phosphorylation and PP2A-dependent dephosphorylation.
25255219 MiR-630 promoted apoptosis by downregulation of CDC7.
23716994 huCdc7 may play an important role in the development and progression of colorectal cancer.
23684929 Cdcy is universally up-regulated in oral squamous cell carcinoma is an independent prognostic marker, contributing to resistance to DNA damaging agents.
23598722 The interaction between Claspin and Cdc7 is not dependent on Cdc7 kinase activity, but Claspin interaction with the DNA helicase subunit Mcm2 is lost upon Cdc7 inhibition.
23066029 Cdc7 phosphorylates and interacts with Tob to inhibit the Cul4-DDB1(Cdt2)-dependent Tob degradation.
22806309 Significantly higher levels of apoptosis were detected in siCDC7-transfected cells.
22574151 cell death process induced by Cdc7 depletion
22528513 The results suggest that CDC7 expression level can be specific prognostic factors for Diffuse large B-cell lymphoma patients
21536671 bipartite interaction between Cdc7 and Dbf4/ASK subunits facilitates ATP binding and substrate recognition by the Cdc7 kinase.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20707412 Data syggest important implications for the continued development of promising Cdc7-targeted cancer therapies.
20647475 Inhibition of Cdc7 kinase activity in cancer cells restricts DNA replication and induces apoptotic cell death by an unprecedented molecular mechanism of action.
20548946 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19896697 cell division cycle 7 is a replication associated protein with relationships to gene amplification and genomic instability in breast carcinomas.
19864417 The interaction with LEDGF relieves autoinhibition of Cdc7-ASK kinase, imposed by the C terminus of ASK.
19647517 Cdc7 phosphorylates Mcm2 promoting pre-replication complex assembly.
19426592 Data show that CDC7L1 and CDC10 was up-regulated but the expression of CDK9, CDC20 and CLK3 was down- regulated in azoospermic testes.
19318489 Increased Cdc7 protein levels were significantly associated with arrested tumor differentiation, advanced clinical stage, genomic instability, and accelerated cell cycle progression.
19278428 differences in Cdc7 expression may account for some of the differences between malignant melanomas and benign melanocytic nevi.
19111665 These results indicate that Ddk functions as an upstream regulator to monitor S-phase checkpoint signaling.
19054765 chromatin-bound CDT1 is first stabilized and subsequently displaced by CDC7 activity, thereby ensuring the timely execution of DNA replication
18714392 increased Cdc7-Dbf4 abundance may be a common occurrence in human malignancies
18625709 the ATR-dependent activation of the p38 MAP kinase is a major signaling pathway that induces apoptotic cell death after depletion of Cdc7 in cancer cells
18286467 Cdc7/Dbf4 kinase activity inhibition affects specific phosphorylation sites on MCM2 in cancer cells
17711849 CRM1 may down-regulate Cdc7 by masking its kinase domain
17062569 Cdc7 kinase plays a role in maintaining cell viability during replication stress
17046832 MCM4 phosphorylation by Cdc7 kinase facilitates its interaction with Cdc45 on chromatin
16899510 Taken together, these results indicate that Cdc7/Dbf4 phosphorylation of MCM2 is essential for the initiation of DNA replication in mammalian cells.
16864800 Results describe the mapping of the sites in human Mcm2 protein that are phosphorylated by Cdc7.
16826239 Cdc7-Dbf4 kinase efficiently phosphorylates p150.
16446360 the majority of the Mcm2 isoforms phosphorylated by Cdc7 are not stably associated with chromatin
16082200 CINP is part of the Cdc7-dependent mechanism of origin firing and a functional and physical link between Cdk2 and Cdc7 complexes at the origins
15668232 ASKL1 in a complex with Cdc7 may play a role in normal progression of both S and M phases
15474462 CR (periphilin) retards S-phase progression by modifying expression of Cdc7 and other genes involved in progression of DNA replication
15466207 Down-regulation of Cdc7 by small interfering RNA in a variety of tumor cell lines causes an abortive S phase, leading to cell death by either p53-independent apoptosis or aberrant mitosis.
12065429 Drf1, a nuclear cell cycle-regulated protein binds to Cdc7 and activates the kinase

AA Sequence

MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKIEDKIGEGTFS      1 - 70
SVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHE     71 - 140
SFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTHDTKIEL    141 - 210
LKFVQSEAQQERCSQNKSHIITGNKIPLSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGL    211 - 280
SVQRSVFGERNFNIHSSISHESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLT    281 - 350
CDCYATDKVCSICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD    351 - 420
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQGHASHQPAIS    421 - 490
EKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPDEAYDLLDKLLDLNPASRITA    491 - 560
EEALLHPFFKDMSL                                                            561 - 574
//

Text Mined References (65)

PMID Year Title
26383992 2015 A Genetic Variant in TGFBR3-CDC7 Is Associated with Visual Field Progression in Primary Open-Angle Glaucoma Patients from Singapore.
26208856 2015 Cdc7 overexpression is an independent prognostic marker and a potential therapeutic target in colorectal cancer.
25258324 2014 Protein phosphatase 2A and Cdc7 kinase regulate the DNA unwinding element-binding protein in replication initiation.
25255219 2014 MiR-630 inhibits proliferation by targeting CDC7 kinase, but maintains the apoptotic balance by targeting multiple modulators in human lung cancer A549 cells.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
23716994 2013 Expression of huCdc7 in colorectal cancer.
23684929 2013 Increased Cdc7 expression is a marker of oral squamous cell carcinoma and overexpression of Cdc7 contributes to the resistance to DNA-damaging agents.
23598722 2013 Cdc7-dependent and -independent phosphorylation of Claspin in the induction of the DNA replication checkpoint.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23066029 2012 Inhibition of DNA damage-induced apoptosis through Cdc7-mediated stabilization of Tob.
22806309 2012 Effects of CDC7 gene silencing and Rituximab on apoptosis in diffuse large B cell lymphoma cells.
22574151 2012 Mechanism of cancer cell death induced by depletion of an essential replication regulator.
22540012 2012 Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
22528513 2012 High expression of cell division cycle 7 protein correlates with poor prognosis in patients with diffuse large B-cell lymphoma.
21536671 2011 Molecular mechanism of activation of human Cdc7 kinase: bipartite interaction with Dbf4/activator of S phase kinase (ASK) activation subunit stimulates ATP binding and substrate recognition.
21307088 2011 Genome-wide association studies in Asians confirm the involvement of ATOH7 and TGFBR3, and further identify CARD10 as a novel locus influencing optic disc area.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20707412 2010 Quantitative proteomics reveals a "poised quiescence" cellular state after triggering the DNA replication origin activation checkpoint.
20647475 2010 Targeting cell division cycle 7 kinase: a new approach for cancer therapy.
20548946 2010 A genome-wide association study of optic disc parameters.
19896697 2010 Overexpression of cell division cycle 7 homolog is associated with gene amplification frequency in breast cancer.
19864417 2010 Transcriptional co-activator LEDGF interacts with Cdc7-activator of S-phase kinase (ASK) and stimulates its enzymatic activity.
19647517 2009 Phosphorylation of Mcm2 by Cdc7 promotes pre-replication complex assembly during cell-cycle re-entry.
19426592 2009 [Expression of cell cycle molecules in human azoospermic testes].
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19318489 2009 Cdc7 kinase is a predictor of survival and a novel therapeutic target in epithelial ovarian carcinoma.
19278428 2009 Cdc7 expression in melanomas, Spitz tumors and melanocytic nevi.
19111665 2008 The role of Dbf4/Drf1-dependent kinase Cdc7 in DNA-damage checkpoint control.
19054765 2009 Human CDT1 associates with CDC7 and recruits CDC45 to chromatin during S phase.
18714392 2008 Cdc7-Dbf4 kinase overexpression in multiple cancers and tumor cell lines is correlated with p53 inactivation.
18625709 2008 ATR-dependent activation of p38 MAP kinase is responsible for apoptotic cell death in cells depleted of Cdc7.
18286467 2008 Inhibition of Cdc7/Dbf4 kinase activity affects specific phosphorylation sites on MCM2 in cancer cells.
17711849 2007 Identification and characterization of human cdc7 nuclear retention and export sequences in the context of chromatin binding.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17102137 2007 Human Tim/Timeless-interacting protein, Tipin, is required for efficient progression of S phase and DNA replication checkpoint.
17062569 2007 Cdc7 is an active kinase in human cancer cells undergoing replication stress.
17046832 2006 Phosphorylation of MCM4 by Cdc7 kinase facilitates its interaction with Cdc45 on the chromatin.
16899510 2006 Essential role of phosphorylation of MCM2 by Cdc7/Dbf4 in the initiation of DNA replication in mammalian cells.
16864800 2006 CDC7 kinase phosphorylates serine residues adjacent to acidic amino acids in the minichromosome maintenance 2 protein.
16826239 2006 The replication kinase Cdc7-Dbf4 promotes the interaction of the p150 subunit of chromatin assembly factor 1 with proliferating cell nuclear antigen.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16446360 2006 Identification of Mcm2 phosphorylation sites by S-phase-regulating kinases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16082200 2005 A novel Cdk2 interactor is phosphorylated by Cdc7 and associates with components of the replication complexes.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15668232 2005 A second human Dbf4/ASK-related protein, Drf1/ASKL1, is required for efficient progression of S and M phases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474462 2004 Overexpression of CR/periphilin downregulates Cdc7 expression and induces S-phase arrest.
15466207 2004 Cdc7 inhibition reveals a p53-dependent replication checkpoint that is defective in cancer cells.
15232106 2004 Self-assembling protein microarrays.
15226314 2004 Human claspin is a ring-shaped DNA-binding protein with high affinity to branched DNA structures.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12614612 2003 Interaction and assembly of murine pre-replicative complex proteins in yeast and mouse cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12065429 2002 Drf1, a novel regulatory subunit for human Cdc7 kinase.
11568184 2001 Biochemical activities associated with mouse Mcm2 protein.
10846177 2000 Human Cdc7-related kinase complex. In vitro phosphorylation of MCM by concerted actions of Cdks and Cdc7 and that of a criticial threonine residue of Cdc7 bY Cdks.
10523313 1999 Mammalian Cdc7-Dbf4 protein kinase complex is essential for initiation of DNA replication.
10373557 1999 A novel growth- and cell cycle-regulated protein, ASK, activates human Cdc7-related kinase and is essential for G1/S transition in mammalian cells.
9573348 1998 A human homolog of the yeast CDC7 gene is overexpressed in some tumors and transformed cell lines.
9405610 1997 Identification and characterization of a human protein kinase related to budding yeast Cdc7p.
9250678 1997 Human and Xenopus cDNAs encoding budding yeast Cdc7-related kinases: in vitro phosphorylation of MCM subunits by a putative human homologue of Cdc7.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.