Property Summary

NCBI Gene PubMed Count 49
PubMed Score 117.60
PubTator Score 63.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.054 8.0e-03
adult high grade glioma 1.400 8.1e-04
atypical teratoid / rhabdoid tumor 1.700 1.7e-06
Breast cancer 1.600 1.4e-11
ductal carcinoma in situ 1.200 4.7e-03
glioblastoma 1.500 2.3e-06
group 3 medulloblastoma 2.600 5.0e-06
invasive ductal carcinoma 1.600 2.8e-04
lung adenocarcinoma 1.300 5.4e-13
lung cancer 1.100 4.8e-03
malignant mesothelioma 3.100 5.6e-09
medulloblastoma, large-cell 2.700 4.4e-07
non-small cell lung cancer 2.635 2.1e-25
osteosarcoma -1.642 3.0e-03
ovarian cancer 1.600 6.2e-08
primitive neuroectodermal tumor 2.000 3.7e-04
psoriasis 1.300 4.5e-13

Gene RIF (27)

AA Sequence

MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFH      1 - 70
YFILINCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEED     71 - 140
EEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLS    141 - 210
KDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRHNHRNEDEENTLSVDCTRISFEYDLRLVL    211 - 280
YQHWSLHDSLCNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQAMDISLKENLREMIEESANK    281 - 350
FGMKDMRVQTFSIHFGFKHKFLASDVVFATMSLMESPEKDGSGTDHFIQALDSLSRSNLDKLYHGLELAK    351 - 420
KQLRATQQTIASCLCTNLVISQGPFLYCSLMEGTPDVMLFSRPASLSLLSKHLLKSFVCSTKNRRCKLLP    421 - 490
LVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDA    491 - 560
LISLLS                                                                    561 - 566
//

Text Mined References (55)

PMID Year Title