Property Summary

NCBI Gene PubMed Count 12
PubMed Score 13.16
PubTator Score 8.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
urothelial carcinoma -1.300 1.2e-03
osteosarcoma -1.804 1.1e-04
atypical teratoid / rhabdoid tumor -1.300 1.1e-03
glioblastoma -1.600 7.1e-05
medulloblastoma -1.400 7.7e-05
medulloblastoma, large-cell -2.400 9.7e-05
primitive neuroectodermal tumor -1.200 2.1e-03
juvenile dermatomyositis 1.077 1.7e-10
acute quadriplegic myopathy 1.322 6.0e-08
adrenocortical carcinoma 1.077 7.2e-04
intraductal papillary-mucinous neoplasm ... 1.400 7.0e-03
pediatric high grade glioma -1.200 2.7e-04
primary Sjogren syndrome 1.700 2.0e-02
subependymal giant cell astrocytoma -1.178 3.8e-02
Endometriosis -1.115 2.8e-02
Breast cancer -1.100 1.0e-15
ductal carcinoma in situ 1.400 1.9e-03
invasive ductal carcinoma 1.100 1.8e-02
ovarian cancer -1.600 7.4e-06
pituitary cancer -1.200 6.0e-05

Gene RIF (5)

PMID Text
23833064 Cdc42 is an important regulator of corneal epithelial wound repair. To promote healing, Cdc42 may interact with receptor tyrosine kinase-activated signaling cascades that participate in cell migration and cell-cycle progression.
18804346 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17030554 Observational study of gene-disease association. (HuGE Navigator)
17030554 haplotypes underlying the SPEC2/PDZ-GEF2/acyl-CoA synthetase long-chain family member 6 region are associated with schizophrenia
15840583 Recruitment of SPEC2 within Jurkat T cells to the antigen-presenting cell interface occurred following incubation with staphylococcal enterotoxin E superantigen-loaded B cells and colocalized there with F-actin and Cdc42. T cell receptor

AA Sequence

MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGM      1 - 70
PANVQMQLVDTKAG                                                             71 - 84
//

Text Mined References (15)

PMID Year Title
23833064 2013 Regulation of Cdc42 expression and signaling is critical for promoting corneal epithelial wound healing.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
18804346 2008 Interaction between interleukin 3 and dystrobrevin-binding protein 1 in schizophrenia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17045588 2007 Biochemical characterization of distinct regions of SPEC molecules and their role in phagocytosis.
17030554 2006 Haplotypes spanning SPEC2, PDZ-GEF2 and ACSL6 genes are associated with schizophrenia.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15840583 2005 The role of SPECs, small Cdc42-binding proteins, in F-actin accumulation at the immunological synapse.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10816584 2000 SPECs, small binding proteins for Cdc42.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.