Property Summary

NCBI Gene PubMed Count 30
PubMed Score 37.50
PubTator Score 18.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (29)

Disease log2 FC p
acute quadriplegic myopathy 2.565 2.2e-08
Amyotrophic lateral sclerosis 1.992 5.4e-09
astrocytic glioma -1.700 1.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.287 5.5e-03
Breast cancer -1.400 4.6e-05
breast carcinoma -1.100 3.5e-23
colon cancer -1.600 1.8e-03
cystic fibrosis and chronic rhinosinusit... -1.240 2.0e-03
dermatomyositis 1.800 1.2e-02
Duchenne muscular dystrophy 1.005 1.8e-06
ependymoma -1.700 1.6e-03
group 4 medulloblastoma 1.700 1.2e-02
hepatocellular carcinoma 1.300 3.1e-06
intraductal papillary-mucinous adenoma (... -1.500 1.6e-03
intraductal papillary-mucinous carcinoma... -1.700 4.6e-02
intraductal papillary-mucinous neoplasm ... -1.500 3.9e-02
juvenile dermatomyositis 1.022 9.5e-09
lung cancer -2.300 1.6e-04
malignant mesothelioma -1.100 7.2e-06
oligodendroglioma -1.500 5.0e-03
osteosarcoma -1.663 7.4e-04
ovarian cancer -1.800 7.2e-08
pancreatic cancer 1.400 5.7e-04
pancreatic carcinoma 1.400 5.7e-04
pituitary cancer 1.300 2.1e-03
primary pancreatic ductal adenocarcinoma 1.074 7.9e-03
psoriasis -2.600 4.6e-05
Rheumatoid arthritis 1.100 7.4e-03
spina bifida -1.082 2.7e-02

Gene RIF (4)

AA Sequence

MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQ      1 - 70
EKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKL     71 - 140
PRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTP    141 - 210
CELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK                              211 - 254
//

Text Mined References (33)

PMID Year Title