Property Summary

NCBI Gene PubMed Count 28
PubMed Score 35.26
PubTator Score 18.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
Rheumatoid Arthritis 1.100 7.4e-03
hepatocellular carcinoma 1.300 3.1e-06
pancreatic cancer 1.400 5.7e-04
malignant mesothelioma -1.100 7.2e-06
astrocytic glioma -2.300 3.0e-03
ependymoma -2.400 5.9e-03
oligodendroglioma -2.200 6.8e-03
psoriasis -2.600 4.6e-05
osteosarcoma -1.663 7.4e-04
group 4 medulloblastoma 1.700 1.2e-02
Duchenne muscular dystrophy 1.123 1.2e-05
autosomal dominant Emery-Dreifuss muscul... 1.287 5.5e-03
juvenile dermatomyositis 1.682 6.9e-13
Amyotrophic Lateral Sclerosis 2.250 3.4e-08
acute quadriplegic myopathy 3.296 2.2e-09
primary pancreatic ductal adenocarcinoma 1.074 7.9e-03
intraductal papillary-mucinous adenoma (... -2.300 1.4e-04
intraductal papillary-mucinous carcinoma... -1.700 4.6e-02
intraductal papillary-mucinous neoplasm ... -1.700 7.5e-03
lung cancer -2.300 1.6e-04
colon cancer -1.600 1.8e-03
pancreatic carcinoma 1.400 5.7e-04
breast carcinoma -1.100 3.5e-23
spina bifida -1.082 2.7e-02
Breast cancer -2.000 5.3e-06
ovarian cancer -3.000 2.0e-06
pituitary cancer 1.300 2.1e-03
cystic fibrosis and chronic rhinosinusit... -1.240 2.0e-03
dermatomyositis 1.800 1.2e-02

Synonym

Accession Q9UKI2 B2R8S0 O95353 Q9UQJ0
Symbols UB1
CEP3
BORG2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20385374 The expression of CDC42EP3 mRNA was significantly increased by 19.7% in dorsal prefrontal cortex in patient with schizophrenia.
18854154 Knockdown of CDC42 effector protein 3 (CDC42EP3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQ      1 - 70
EKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKL     71 - 140
PRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTP    141 - 210
CELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK                              211 - 254
//

Text Mined References (31)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681909 2012 Genes responsible for the characteristics of primary cultured invasive phenotype hepatocellular carcinoma cells.
22451153 2012 Identification and characterization of genes related to the development of breast muscles in Pekin duck.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20385374 2010 Altered cortical CDC42 signaling pathways in schizophrenia: implications for dendritic spine deficits.
17692555 2007 The intracellular form of human MAGP1 elicits a complex and specific transcriptional response.
17173092 2006 Human fertility protein PUMILIO2 interacts in vitro with testis mRNA encoding Cdc42 effector 3 (CEP3).
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16908841 2006 A FoxO-Smad synexpression group in human keratinocytes.
16466844 Gene expression profiles of U937 human macrophages exposed to Chlamydophila pneumoniae and/or low density lipoprotein in five study models using differential display and real-time RT-PCR.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11584266 2001 Borg proteins control septin organization and are negatively regulated by Cdc42.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11035016 2001 A new family of Cdc42 effector proteins, CEPs, function in fibroblast and epithelial cell shape changes.
10490598 1999 The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins.
9535835 1998 Analysis of RhoA-binding proteins reveals an interaction domain conserved in heterotrimeric G protein beta subunits and the yeast response regulator protein Skn7.