Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.80
PubTator Score 1.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis -1.100 2.3e-02
osteosarcoma 1.090 8.9e-03
active ulcerative colitis 1.379 1.6e-02
group 4 medulloblastoma -1.200 1.1e-04
ductal carcinoma in situ -1.100 6.0e-04
ovarian cancer -1.100 1.9e-09

Gene RIF (2)

PMID Text
20934684 CDC42EP2 is upregulated in human PDLCs subjected to tensile stress related to mechano-induced cell cycle arrest.
16395716 activations of Rac1 and Cdc42 are involved in the hypoxia-induced production of angiogenesis-promoting factors and tumor suppressors, and suggest that the Rho family GTPases Rac1 and Cdc42 may contribute to the hypoxia-mediated angiogenesis.

AA Sequence

MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMV      1 - 70
EGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQP     71 - 140
SPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT    141 - 210
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20936779 2010 A human MAP kinase interactome.
20934684 2011 Early proliferation alteration and differential gene expression in human periodontal ligament cells subjected to cyclic tensile stress.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16395716 2006 Role of Rac1 and Cdc42 in hypoxia induced p53 and von Hippel-Lindau suppression and HIF1alpha activation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11584266 2001 Borg proteins control septin organization and are negatively regulated by Cdc42.
11035016 2001 A new family of Cdc42 effector proteins, CEPs, function in fibroblast and epithelial cell shape changes.
10490598 1999 The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins.
10430899 1999 MSE55, a Cdc42 effector protein, induces long cellular extensions in fibroblasts.
9253601 1997 A transcript map for the 2.8-Mb region containing the multiple endocrine neoplasia type 1 locus.