Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.02
PubTator Score 1.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis 1.379 1.6e-02
ductal carcinoma in situ -1.100 6.0e-04
group 4 medulloblastoma -1.200 1.1e-04
osteosarcoma 1.090 8.9e-03
ovarian cancer -1.100 1.9e-09
Rheumatoid arthritis -1.100 2.3e-02

Gene RIF (3)

AA Sequence

MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMV      1 - 70
EGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQP     71 - 140
SPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT    141 - 210
//

Text Mined References (22)

PMID Year Title