Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.94
PubTator Score 9.55

Knowledge Summary

Patent (1,500)

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.600 1.9e-07
osteosarcoma 2.518 6.8e-07
astrocytoma 1.100 3.0e-02
autosomal dominant Emery-Dreifuss muscul... 1.078 3.8e-03
Breast cancer -2.900 3.9e-02
mucosa-associated lymphoid tissue lympho... 1.427 5.5e-03
Gaucher disease type 1 1.600 2.7e-02

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (5)

PMID Text
21949762 these results provide further validation for MRCK involvement in regulation of cancer cell invasion.
21240187 Cdc42-dependent formation of the ZO-1/MRCKbeta complex at the leading edge controls cell migration.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20177145 Q-PCR results demonstrated VH2 genes were overexpressed in ankylosing spondylitis patients. The sequence analysis revealed the majority of them contained CDC42 binding protein kinase Beta (CDC42 BPB) genes.
18263588 analysis of the interaction of phorbol esters with the C1 domain of MRCK (myotonic dystrophy kinase-related Cdc42 binding kinase) alpha/beta

AA Sequence

MSAKVRLKKLEQLLLDGPWRNESALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAKPFTQLVKEMQ      1 - 70
LHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETACFREERDVLVNGDCQWITALH     71 - 140
YAFQDENHLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFYIGEMVLAIDSIHQLHYVHRDIKPDNVLLDV    141 - 210
NGHIRLADFGSCLKMNDDGTVQSSVAVGTPDYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETP    211 - 280
FYAESLVETYGKIMNHEERFQFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEGLNWENI    281 - 350
RNLEAPYIPDVSSPSDTSNFDVDDDVLRNTEILPPGSHTGFSGLHLPFIGFTFTTESCFSDRGSLKSIMQ    351 - 420
SNTLTKDEDVQRDLEHSLQMEAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSSRALSNSNRDKEIKKL    421 - 490
NEEIERLKNKIADSNRLERQLEDTVALRQEREDSTQRLRGLEKQHRVVRQEKEELHKQLVEASERLKSQA    491 - 560
KELKDAHQQRKLALQEFSELNERMAELRAQKQKVSRQLRDKEEEMEVATQKVDAMRQEMRRAEKLRKELE    561 - 630
AQLDDAVAEASKERKLREHSENFCKQMESELEALKVKQGGRGAGATLEHQQEISKIKSELEKKVLFYEEE    631 - 700
LVRREASHVLEVKNVKKEVHDSESHQLALQKEILMLKDKLEKSKRERHNEMEEAVGTIKDKYERERAMLF    701 - 770
DENKKLTAENEKLCSFVDKLTAQNRQLEDELQDLAAKKESVAHWEAQIAEIIQWVSDEKDARGYLQALAS    771 - 840
KMTEELEALRSSSLGSRTLDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLVQEELRKVKDANLTLESK    841 - 910
LKDSEAKNRELLEEMEILKKKMEEKFRADTGLKLPDFQDSIFEYFNTAPLAHDLTFRTSSASEQETQAPK    911 - 980
PEASPSMSVAASEQQEDMARPPQRPSAVPLPTTQALALAGPKPKAHQFSIKSFSSPTQCSHCTSLMVGLI    981 - 1050
RQGYACEVCSFACHVSCKDGAPQVCPIPPEQSKRPLGVDVQRGIGTAYKGHVKVPKPTGVKKGWQRAYAV   1051 - 1120
VCDCKLFLYDLPEGKSTQPGVIASQVLDLRDDEFSVSSVLASDVIHATRRDIPCIFRVTASLLGAPSKTS   1121 - 1190
SLLILTENENEKRKWVGILEGLQSILHKNRLRNQVVHVPLEAYDSSLPLIKAILTAAIVDADRIAVGLEE   1191 - 1260
GLYVIEVTRDVIVRAADCKKVHQIELAPREKIVILLCGRNHHVHLYPWSSLDGAEGSFDIKLPETKGCQL   1261 - 1330
MATATLKRNSGTCLFVAVKRLILCYEIQRTKPFHRKFNEIVAPGSVQCLAVLRDRLCVGYPSGFCLLSIQ   1331 - 1400
GDGQPLNLVNPNDPSLAFLSQQSFDALCAVELESEEYLLCFSHMGLYVDPQGRRARAQELMWPAAPVACS   1401 - 1470
CSPTHVTVYSEYGVDVFDVRTMEWVQTIGLRRIRPLNSEGTLNLLNCEPPRLIYFKSKFSGAVLNVPDTS   1471 - 1540
DNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLS   1541 - 1610
AVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTPS   1611 - 1680
NSSNPSGPPSPNSPHRSQLPLEGLEQPACDT                                          1681 - 1711
//

Text Mined References (29)

PMID Year Title
25743393 2015 CCM-3/STRIPAK promotes seamless tube extension through endocytic recycling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21949762 2011 Co-crystal structures of inhibitors with MRCK?, a key regulator of tumor cell invasion.
21471979 2011 Common variants on 14q32 and 13q12 are associated with DLBCL susceptibility.
21457715 2011 Chelerythrine perturbs lamellar actomyosin filaments by selective inhibition of myotonic dystrophy kinase-related Cdc42-binding kinase.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21240187 2011 Cdc42-dependent formation of the ZO-1/MRCK? complex at the leading edge controls cell migration.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20177145 2010 Overexpression and unique rearrangement of VH2 transcripts in immunoglobulin variable heavy chain genes in ankylosing spondylitis patients.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18854160 2008 A tripartite complex containing MRCK modulates lamellar actomyosin retrograde flow.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18263588 2008 Characterization of the interaction of phorbol esters with the C1 domain of MRCK (myotonic dystrophy kinase-related Cdc42 binding kinase) alpha/beta.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
10198171 1999 Cloning and chromosomal localization of human Cdc42-binding protein kinase beta.
9418861 1998 Myotonic dystrophy kinase-related Cdc42-binding kinase acts as a Cdc42 effector in promoting cytoskeletal reorganization.