Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.99
PubTator Score 6.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.200 1.7e-02
psoriasis -2.000 3.7e-05
atypical teratoid / rhabdoid tumor -1.100 2.9e-05
glioblastoma -1.300 1.9e-04
medulloblastoma, large-cell -1.200 3.3e-03
tuberculosis and treatment for 6 months 1.100 2.0e-03
aldosterone-producing adenoma -1.053 1.7e-02
ovarian cancer -1.700 4.1e-11
Gaucher disease type 1 -1.200 1.2e-02

 GO Function (1)

Gene RIF (2)

PMID Text
19420964 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of cell division cycle 40 homolog (CDC40) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGV      1 - 70
HLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALD     71 - 140
PSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSE    141 - 210
EEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQ    211 - 280
IHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSA    281 - 350
AYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGA    351 - 420
VNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGA    421 - 490
QNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHP    491 - 560
HETSKVITCGWDGLIKLWD                                                       561 - 579
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19420964 2009 Somatic mutations of the CDC4 (FBXW7) gene in hereditary colorectal tumors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11102353 2000 Genetic and physical interactions between factors involved in both cell cycle progression and pre-mRNA splicing in Saccharomyces cerevisiae.
9830021 1998 Functional conservation of the human homolog of the yeast pre-mRNA splicing factor Prp17p.
9769104 1998 Identification and functional analysis of hPRP17, the human homologue of the PRP17/CDC40 yeast gene involved in splicing and cell cycle control.
9524131 1998 Human homologs of yeast prp16 and prp17 reveal conservation of the mechanism for catalytic step II of pre-mRNA splicing.
9303539 1997 Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7568168 1995 A protein-binding domain, EH, identified in the receptor tyrosine kinase substrate Eps15 and conserved in evolution.