Property Summary

NCBI Gene PubMed Count 99
PubMed Score 12.45
PubTator Score 84.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Inflammatory Bowel Diseases 87
Disease Target Count P-value
ovarian cancer 8491 9.7e-05
dermatomyositis 966 4.4e-03
colon cancer 1475 2.4e-02
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer 1.100 2.4e-02
ovarian cancer 1.200 9.7e-05
dermatomyositis -1.100 4.4e-03

Gene RIF (45)

PMID Text
26511315 Apart from these distinct Cdc37/Hsp90 interfaces, binding of the B-Raf protein kinase to the cochaperone is conserved between mammals and nematodes.
25852146 RIP3 activation following the induction of necroptosis requires the activity of an HSP90 and CDC37 cochaperone complex.
25619116 The N-terminal tail serves as an intramolecular chaperone ensuring that CDC37 assumes one of two interconvertible states in a manner impacting the interaction of the client binding N-domain and the MC-domains, involved in dimerization and HSP90 binding.
25098386 Suppressing expression of the cochaperone CDC37 in hepatocellular carcinoma cells inhibits cell cycle progression and cell growth.
24927996 As a novel Hsp90 inhibitor, FW-04-806 binds to the N-terminal of Hsp90 and inhibits Hsp90/Cdc37 interaction, resulting in the disassociation of Hsp90/Cdc37/client complexes and the degradation of Hsp90 client proteins.
24869908 Correlation between PDZK1, Cdc37, Akt and breast cancer malignancy: the role of PDZK1 in cell growth through Akt stabilization by increasing and interacting with Cdc37
24379398 SGK3 stability and kinase activation are regulated by the Hsp90-Cdc37 chaperone complex.
24292678 CDC37 has an important role in chaperoning protein kinases; it stabilizes kinase clients by a mechanism that is not dependent on a substantial direct interaction between CDC37 and HSP90, but requires HSP90 activity
23584476 CDC37 is a crucial HSP90-cofactor for KIT oncogenic expression in gastrointestinal stromal tumors
23569206 Cdc37 (cell division cycle 37) restricts Hsp90 (heat shock protein 90) motility by interaction with N-terminal and middle domain binding sites.
23428871 ERK5 interacts with the Hsp90-Cdc37 chaperone in resting cells, and inhibition of Hsp90 or Cdc37 results in ERK5 ubiquitylation and proteasomal degradation.
23281476 analysis of a novel interaction between the co-chaperone Cdc37 and Rho GTPase exchange factor Vav3 promotes androgen receptor activity and prostate cancer growth
22912728 an essential role for surface Cdc37 in concert with HSP90 on the cell surface during cancer cell invasion processes
22727666 A series of tyrosine phosphorylation events, involving both p50(Cdc37) and Hsp90, are minimally sufficient to provide directionality to the chaperone cycle.
22674575 Data show that part of the normal clearance cascade for TDP-43 involves the Cdc37/Hsp90 complex.
22199355 Cdc37-mediated direct interaction between Hsp90/Cdc37 and an IRE1alpha cytosolic motif is important to maintain basal IRE1alpha activity and contributes to normal protein homeostasis and unfolded protein response under physiological stimulation.
21871133 The primary mechanisms by which apigenin kill multiple myeloma cells is by targeting the trinity of CK2-Cdc37-Hsp90.
21367866 the Hsp90 kinase co-chaperone Cdc37 regulates tau stability and phosphorylation dynamics
20299663 Hsp90-Cdc37 complex acta as an endogenous regulator of noncanonical p38alpha activity.
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19858214 celastrol may represent a new class of Hsp90 inhibitor by modifying Hsp90 C terminus to allosterically regulate its chaperone activity and disrupt Hsp90-Cdc37 complex.
19091746 C-terminal tail and determinants in the alphaE-helix of the catalytic domain allows the chaperones Hsp90 and Cdc37 to bind newly synthesized PKC beta II, a required event in the processing of PKC by phosphorylation
19073599 The human Cdc37.Hsp90 complex studied by heteronuclear NMR spectroscopy.
18931700 CDC37 in concert with HSP90 plays an essential role in maintaining oncogenic protein kinase clients including ERBB2, CRAF, CDK4, CDK6, & phosphorylated AKT.
18922470 These data reveal a cyclic regulatory mechanism for Cdc37, in which its constitutive phosphorylation is reversed by targeted dephosphorylation in Hsp90 complexes.
18089825 Cdc37 is essential for maintaining prostate tumor cell growth and may represent a novel target in the search for multitargeted therapies.
18003639 identify Pink1 as a novel Cdc37/Hsp90 client kinase
17728246 The present data denote Hsp90-Cdc37 as a transiently acting essential regulatory component of IKK signaling.
17223712 these observations support the hypothesis that there is a specific coordination between the activation of the cytosolic Ah receptor and the c-Src- and cdc37-containing HSP90 complex.
16949366 The data shows the expression and purification of an Hsp90-Cdc37-Cdk4 complex, defining its stoichiometry, and determining its 3D structure by single-particle electron microscopy.
16611982 N-terminal glycine-rich loop of protein kinases is essential for physically associating with Cdc37.
16280321 JAK1/2 are client proteins of Hsp90 alpha and beta; Hsp90 and CDC37 play a critical role in types I and II interferon pathways
16156789 results suggest that a region of Cdc37 other than the client-binding site may be responsible for discriminating client protein kinases from others
16132836 Nuclear magnetic resonance study of binding to to HSP90.
15850399 Cdc37 is found to heterodimerize with heat-shock protein 90 (Hsp90)-associating relative of Cdc37 (Harc) in vitro.
15647277 the Hsp90.Cdc37 molecular chaperone module has a central role in interleukin-1 receptor-associated-kinase-dependent signaling by toll-like receptors
15001580 Hsp90/p50cdc37 is required for mixed-lineage kinase (MLK) 3 signaling
14701845 the interaction of Cdc37 with its client protein kinases requires amino acid residues within a motif that is present in many protein kinases
14668798 Heteromeric comlpexes containing the molecular chaperones Hsp90 and Cdc37/p50 interacts with the kinase domain of LKB1.
12930845 phosphorylation of Cdc37 on Ser13 is critical for its ability to coordinate Hsp90 nucleotide-mediated conformational switching and kinase binding
12489981 Results show that Cdc37 and heat shock protein 90 bind specifically to the kinase domain of LKB1.
12176997 CDC37 binds to Akt and HSP90 in the signal transduction pathway in human tumor cells
11916974 role in regulating Hsp90 ATPase activity
11864612 Tnf-induced recruitment and activation of the IKK complex require Cdc37 and Hsp90.
10617616 Hsp70 and Hsp90 and Cdc37 regulate the stabilization and folding of CDK9 as well as the assembly of an active CDK9/cyclin T1 complex responsible for P-TEFb-mediated HIV-1 Tat transactivation

AA Sequence

MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRKVAECQRKLKE      1 - 70
LEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKDGFSKSMVNTKPEKTEEDS     71 - 140
EEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVA    141 - 210
HQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEE    211 - 280
EERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASE    281 - 350
AKEGEEAGPGDPLLEAVPKTGDEKDVSV                                              351 - 378
//

Text Mined References (111)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
26511315 2015 Hsp90·Cdc37 Complexes with Protein Kinases Form Cooperatively with Multiple Distinct Interaction Sites.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25852146 2015 A cytosolic heat shock protein 90 and cochaperone CDC37 complex is required for RIP3 activation during necroptosis.
25619116 2015 Phosphorylated and unphosphorylated serine 13 of CDC37 stabilize distinct interactions between its client and HSP90 binding domains.
25486457 2015 Middle domain of human Hsp90 isoforms differentially binds Aha1 in human cells and alters Hsp90 activity in yeast.
25098386 2015 Suppressing the CDC37 cochaperone in hepatocellular carcinoma cells inhibits cell cycle progression and cell growth.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24927996 2014 FW-04-806 inhibits proliferation and induces apoptosis in human breast cancer cells by binding to N-terminus of Hsp90 and disrupting Hsp90-Cdc37 complex formation.
24880080 2014 SMYD2-dependent HSP90 methylation promotes cancer cell proliferation by regulating the chaperone complex formation.
24869908 2014 Correlation between PDZK1, Cdc37, Akt and breast cancer malignancy: the role of PDZK1 in cell growth through Akt stabilization by increasing and interacting with Cdc37.
24618592 2014 Hepatitis B virus polymerase suppresses NF-?B signaling by inhibiting the activity of IKKs via interaction with Hsp90?.
24379398 2014 Coordinated regulation of serum- and glucocorticoid-inducible kinase 3 by a C-terminal hydrophobic motif and Hsp90-Cdc37 chaperone complex.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24292678 2015 Restricting direct interaction of CDC37 with HSP90 does not compromise chaperoning of client proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
23584476 2014 Genome-wide functional screening identifies CDC37 as a crucial HSP90-cofactor for KIT oncogenic expression in gastrointestinal stromal tumors.
23569206 2013 Cdc37 (cell division cycle 37) restricts Hsp90 (heat shock protein 90) motility by interaction with N-terminal and middle domain binding sites.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23428871 2013 Canonical and kinase activity-independent mechanisms for extracellular signal-regulated kinase 5 (ERK5) nuclear translocation require dissociation of Hsp90 from the ERK5-Cdc37 complex.
23281476 2013 Novel interaction between the co-chaperone Cdc37 and Rho GTPase exchange factor Vav3 promotes androgen receptor activity and prostate cancer growth.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23075850 2012 Progressive degeneration of human neural stem cells caused by pathogenic LRRK2.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22912728 2012 Cell surface Cdc37 participates in extracellular HSP90 mediated cancer cell invasion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22727666 2012 Dynamic tyrosine phosphorylation modulates cycling of the HSP90-P50(CDC37)-AHA1 chaperone machine.
22674575 2012 Cdc37/Hsp90 protein complex disruption triggers an autophagic clearance cascade for TDP-43 protein.
22612223 2012 The G2385R variant of leucine-rich repeat kinase 2 associated with Parkinson's disease is a partial loss-of-function mutation.
22199355 2012 Cdc37/Hsp90 protein-mediated regulation of IRE1? protein activity in endoplasmic reticulum stress response and insulin synthesis in INS-1 cells.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21871133 2011 Apigenin inhibits proliferation and induces apoptosis in human multiple myeloma cells through targeting the trinity of CK2, Cdc37 and Hsp90.
21855797 2011 Hsp90-Cdc37 chaperone complex regulates Ulk1- and Atg13-mediated mitophagy.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21367866 2011 The Hsp90 kinase co-chaperone Cdc37 regulates tau stability and phosphorylation dynamics.
21360678 2011 Label-free quantitative proteomics and SAINT analysis enable interactome mapping for the human Ser/Thr protein phosphatase 5.
21269460 2011 Initial characterization of the human central proteome.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
20642453 2010 14-3-3 binding to LRRK2 is disrupted by multiple Parkinson's disease-associated mutations and regulates cytoplasmic localization.
20562859 2010 Network organization of the human autophagy system.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20299663 2010 Specific regulation of noncanonical p38alpha activation by Hsp90-Cdc37 chaperone complex in cardiomyocyte.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19875381 2010 A proteomic investigation of ligand-dependent HSP90 complexes reveals CHORDC1 as a novel ADP-dependent HSP90-interacting protein.
19858214 2009 Characterization of celastrol to inhibit hsp90 and cdc37 interaction.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19091746 2009 The chaperones Hsp90 and Cdc37 mediate the maturation and stabilization of protein kinase C through a conserved PXXP motif in the C-terminal tail.
19073599 2009 The human Cdc37.Hsp90 complex studied by heteronuclear NMR spectroscopy.
19026643 2008 HSP90 is required for TAK1 stability but not for its activation in the pro-inflammatory signaling pathway.
18931700 2009 Silencing the cochaperone CDC37 destabilizes kinase clients and sensitizes cancer cells to HSP90 inhibitors.
18922470 2008 Hsp90-dependent activation of protein kinases is regulated by chaperone-targeted dephosphorylation of Cdc37.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18367605 2008 The chaperone activity of heat shock protein 90 is critical for maintaining the stability of leucine-rich repeat kinase 2.
18089825 2007 Targeting Cdc37 inhibits multiple signaling pathways and induces growth arrest in prostate cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18003639 2008 Pink1 Parkinson mutations, the Cdc37/Hsp90 chaperones and Parkin all influence the maturation or subcellular distribution of Pink1.
17979178 2007 A novel tandem affinity purification strategy for the efficient isolation and characterisation of native protein complexes.
17728246 2007 Signal responsiveness of IkappaB kinases is determined by Cdc37-assisted transient interaction with Hsp90.
17709345 2007 Ubc9 fusion-directed SUMOylation identifies constitutive and inducible SUMOylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17349580 2007 Structures of lung cancer-derived EGFR mutants and inhibitor complexes: mechanism of activation and insights into differential inhibitor sensitivity.
17223712 2007 Rapid activation of c-Src kinase by dioxin is mediated by the Cdc37-HSP90 complex as part of Ah receptor signaling in MCF10A cells.
16949366 2006 Structure of an Hsp90-Cdc37-Cdk4 complex.
16611982 2006 Cdc37 interacts with the glycine-rich loop of Hsp90 client kinases.
16381901 2006 The LIFEdb database in 2006.
16321986 2006 The Parkinson disease causing LRRK2 mutation I2020T is associated with increased kinase activity.
16280321 2006 The heat shock protein 90-CDC37 chaperone complex is required for signaling by types I and II interferons.
16156789 2005 A client-binding site of Cdc37.
16132836 2005 1H, 13C and 15N backbone resonance assignment of the Hsp90 binding domain of human Cdc37.
15850399 2005 Domain-mediated dimerization of the Hsp90 cochaperones Harc and Cdc37.
15647277 2005 A central role for the Hsp90.Cdc37 molecular chaperone module in interleukin-1 receptor-associated-kinase-dependent signaling by toll-like receptors.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15082798 2004 CK2 controls multiple protein kinases by phosphorylating a kinase-targeting molecular chaperone, Cdc37.
15001580 2004 Hsp90/p50cdc37 is required for mixed-lineage kinase (MLK) 3 signaling.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14718169 2004 The Mechanism of Hsp90 regulation by the protein kinase-specific cochaperone p50(cdc37).
14701845 2004 Identification of a conserved sequence motif that promotes Cdc37 and cyclin D1 binding to Cdk4.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14668798 2003 Stability of the Peutz-Jeghers syndrome kinase LKB1 requires its binding to the molecular chaperones Hsp90/Cdc37.
12930845 2003 Phosphorylation of serine 13 is required for the proper function of the Hsp90 co-chaperone, Cdc37.
12907640 2003 Cdc37 enhances proliferation and is necessary for normal human prostate epithelial cell survival.
12489981 2003 Heat-shock protein 90 and Cdc37 interact with LKB1 and regulate its stability.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437126 2002 The Hsp90 co-chaperones Cdc37 and Sti1 interact physically and genetically.
12176997 2002 Akt forms an intracellular complex with heat shock protein 90 (Hsp90) and Cdc37 and is destabilized by inhibitors of Hsp90 function.
11864612 2002 TNF-induced recruitment and activation of the IKK complex require Cdc37 and Hsp90.
11413142 2001 Identification and characterization of Harc, a novel Hsp90-associating relative of Cdc37.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11085988 2001 Functional interaction of human Cdc37 with the androgen receptor but not with the glucocorticoid receptor.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11036079 2001 Hsp90 regulates p50(cdc37) function during the biogenesis of the activeconformation of the heme-regulated eIF2 alpha kinase.
10858314 2000 p50(cdc37) is a nonexclusive Hsp90 cohort which participates intimately in Hsp90-mediated folding of immature kinase molecules.
10617616 2000 Requirement for a kinase-specific chaperone pathway in the production of a Cdk9/cyclin T1 heterodimer responsible for P-TEFb-mediated tat stimulation of HIV-1 transcription.
10409742 1999 Kinase suppressor of Ras forms a multiprotein signaling complex and modulates MEK localization.
10022854 1999 p50(cdc37) acting in concert with Hsp90 is required for Raf-1 function.
9685350 1998 p50(cdc37) binds directly to the catalytic domain of Raf as well as to a site on hsp90 that is topologically adjacent to the tetratricopeptide repeat binding site.
9660753 1998 Specific binding of tetratricopeptide repeat proteins to the C-terminal 12-kDa domain of hsp90.
9482106 1998 Active cdk6 complexes are predominantly nuclear and represent only a minority of the cdk6 in T cells.
9242486 1997 Cdc37 is a molecular chaperone with specific functions in signal transduction.
9150368 1997 Interaction between Cdc37 and Cdk4 in human cells.
8885235 1996 CDC37 is required for p60v-src activity in yeast.
8703009 1996 Physical interaction of mammalian CDC37 with CDK4.
8666233 1996 Mammalian p50Cdc37 is a protein kinase-targeting subunit of Hsp90 that binds and stabilizes Cdk4.