Property Summary

NCBI Gene PubMed Count 109
PubMed Score 12.80
PubTator Score 84.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 9.7e-05
dermatomyositis 966 4.4e-03
colon cancer 1478 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer 1.100 2.4e-02
dermatomyositis -1.100 4.4e-03
ovarian cancer 1.200 9.7e-05

PDB (10)

Gene RIF (51)

AA Sequence

MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRKVAECQRKLKE      1 - 70
LEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKDGFSKSMVNTKPEKTEEDS     71 - 140
EEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVA    141 - 210
HQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEE    211 - 280
EERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASE    281 - 350
AKEGEEAGPGDPLLEAVPKTGDEKDVSV                                              351 - 378
//

Text Mined References (120)

PMID Year Title