Property Summary

NCBI Gene PubMed Count 74
PubMed Score 84.65
PubTator Score 58.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Pyomyositis 1 3.592 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.900 3.2e-03
osteosarcoma -1.905 9.0e-05
atypical teratoid / rhabdoid tumor -2.100 4.4e-06
glioblastoma -2.000 6.3e-04
medulloblastoma -1.600 4.4e-04
medulloblastoma, large-cell -2.200 3.3e-06
lung cancer 1.200 6.2e-04
active Crohn's disease 1.145 6.1e-03
ulcerative colitis 1.100 9.3e-06
ovarian cancer 2.000 8.0e-05

Synonym

Accession P30260 G3V1C4 Q16349 Q96F35
Symbols APC3
HNUC
NUC2
H-NUC
ANAPC3
CDC27Hs
D0S1430E
D17S978E

Gene

PDB

4UI9   5A31   5G04   5G05   5KHR   5L9U   5LCW   3T1N   4RG6   4RG9   4RG7  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (14)

PMID Text
26882976 Cdc27 is a novel binding partner of Elmo1.Cdc27-Elmo1 has a cellular role independent from the Elmo-Dock1-Rac signal module.
25943633 miR-27a could modulate proliferation and radiosensitivity of TNBC cells. CDC-27 is a direct target of miR-27a and its downregulation conferred increased radioresistance of the cells.
25680405 These findings suggested that polymorphisms in cdc27 may contribute to the susceptibility of BC though functional studies are needed to further elucidate the underling mechanisms of the associations
25490258 The structures show how one APC16 binds asymmetrically to the symmetric APC3 dimer and, together with biochemistry and prior data, explain how APC16 recruits APC7 to APC3.
23923534 Down-regulation of CDC27 protein is associated with radiation resistance.
23755904 Low cdc27 and high securin expression predict short survival for breast cancer patients.
23078409 Data indicate that additional density present in the anaphase-promoting complex (APC/C) structure, proximal to Apc3/Cdc27 of the (tetratricopeptide repeat) lobe, is assigned to the TPR subunit Apc7, a subunit specific to vertebrate APC/C.
22139841 the biochemical, structural, and cellular determinants of the novel interaction between MCPH1 and Cdc27 and suggest that this interaction may occur within the larger context of MCPH1-APC/C.
21336306 Cdc20 requires APC3 and APC8 to bind and activate the APC/C when the spindle assembly checkpoint is satisfied, but only APC8 when active, and APC10 is crucial for the destruction of cyclin B1 and securin, but not cyclin A
21209074 phosphorylation of Cdc27 by CKII is involved in TGF-beta-induced activation of APC.
20508983 Observational study of gene-disease association. (HuGE Navigator)
17827148 The interaction is direct and is mediated by the tandem BRCA1 C-terminal domains of MDC1 and the C terminus of the Cdc27 (APC3) subunit of the anaphase-promoting complex/cyclosome.
12853486 HOXC10 co-immunoprecipitates the APC subunit CDC27, and its in vitro degradation is reduced in APC-depleted extracts or by competition with the APC substrate cyclin A.
12429948 the spindle checkpoint may regulate CDC27/APC activity at mitosis

AA Sequence

MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQ      1 - 70
CKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQK     71 - 140
SLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTI    141 - 210
ELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTP    211 - 280
SFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQ    281 - 350
SSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQ    351 - 420
PNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSH    421 - 490
LPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT    491 - 560
DMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRV    561 - 630
NPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDP    631 - 700
KNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKG    701 - 770
ANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF                    771 - 824
//

Text Mined References (85)

PMID Year Title
26882976 2016 Identification of a novel protein interaction between Elmo1 and Cdc27.
25943633 2015 MiR-27a modulates radiosensitivity of triple-negative breast cancer (TNBC) cells by targeting CDC27.
25680405 2015 Association between polymorphisms in cdc27 and breast cancer in a Chinese population.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25490258 2015 Structure of an APC3-APC16 complex: insights into assembly of the anaphase-promoting complex/cyclosome.
25416956 2014 A proteome-scale map of the human interactome network.
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
24781523 2014 PP2A delays APC/C-dependent degradation of separase-associated but not free securin.
24699064 2014 Discovery of biclonal origin and a novel oncogene SLC12A5 in colon cancer by single-cell sequencing.
24576404 2014 Identification of somatic mutations in EGFR/KRAS/ALK-negative lung adenocarcinoma in never-smokers.
24324762 2013 Decoy oligonucleotide rescues IGF1R expression from MicroRNA-223 suppression.
24073851 2013 Structural basis for the BRCA1 BRCT interaction with the proteins ATRIP and BAAT1.
23923534 2005 CDC27 protein is involved in radiation response in squamous cell cervix carcinoma.
23874428 2013 Reconstruction of an integrated genome-scale co-expression network reveals key modules involved in lung adenocarcinoma.
23755904 2013 Low cdc27 and high securin expression predict short survival for breast cancer patients.
23583778 2013 The four canonical tpr subunits of human APC/C form related homo-dimeric structures and stack in parallel to form a TPR suprahelix.
23265383 2013 The mitochondrial and autosomal mutation landscapes of prostate cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160376 2013 Transcriptional intermediary factor 1? binds to the anaphase-promoting complex/cyclosome and promotes mitosis.
23078409 2013 Recombinant expression, reconstitution and structure of human anaphase-promoting complex (APC/C).
22139841 2012 Molecular basis for the association of microcephalin (MCPH1) protein with the cell division cycle protein 27 (Cdc27) subunit of the anaphase-promoting complex.
22014574 2011 SIRT2 maintains genome integrity and suppresses tumorigenesis through regulating APC/C activity.
21926987 2011 APC15 drives the turnover of MCC-CDC20 to make the spindle assembly checkpoint responsive to kinetochore attachment.
21336306 2011 How APC/C-Cdc20 changes its substrate specificity in mitosis.
21307936 2011 Structural basis for the subunit assembly of the anaphase-promoting complex.
21269460 2011 Initial characterization of the human central proteome.
21241890 2011 Nuclear PTEN regulates the APC-CDH1 tumor-suppressive complex in a phosphatase-independent manner.
21209074 2011 Phosphorylation of the anaphase-promoting complex/Cdc27 is involved in TGF-beta signaling.
20951947 2010 Pharmacologic inhibition of the anaphase-promoting complex induces a spindle checkpoint-dependent mitotic arrest in the absence of spindle damage.
20802534 2011 Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18662541 2008 The Cdc14B-Cdh1-Plk1 axis controls the G2 DNA-damage-response checkpoint.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17827148 2007 The DNA damage response mediator MDC1 directly interacts with the anaphase-promoting complex/cyclosome.
17719540 2007 A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16648845 2006 Early mitotic degradation of Nek2A depends on Cdc20-independent interaction with the APC/C.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16364912 2005 Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14657031 2003 Mitotic regulation of the human anaphase-promoting complex by phosphorylation.
14593737 2003 The mitotic checkpoint: a signaling pathway that allows a single unattached kinetochore to inhibit mitotic exit.
12853486 2003 Early mitotic degradation of the homeoprotein HOXC10 is potentially linked to cell cycle progression.
12797865 2003 Differential expression, localization and activity of two alternatively spliced isoforms of human APC regulator CDH1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429948 The dephosphorylated form of the anaphase-promoting complex protein Cdc27/Apc3 concentrates on kinetochores and chromosome arms in mitosis.
12196507 2002 Rapid microtubule-independent dynamics of Cdc20 at kinetochores and centrosomes in mammalian cells.
12070128 2002 Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.
11742988 2001 APC/C-mediated destruction of the centrosomal kinase Nek2A occurs in early mitosis and depends upon a cyclin A-type D-box.
11691834 2001 Smad3 recruits the anaphase-promoting complex for ubiquitination and degradation of SnoN.
11535616 2001 Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.
11524682 2001 Crystal structure of the APC10/DOC1 subunit of the human anaphase-promoting complex.
11340163 2001 A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
10939594 2000 Phosphorylation-dependent proline isomerization catalyzed by Pin1 is essential for tumor cell survival and entry into mitosis.
10922056 2000 The RING-H2 finger protein APC11 and the E2 enzyme UBC4 are sufficient to ubiquitinate substrates of the anaphase-promoting complex.
10793135 2000 Mitotic regulation of the APC activator proteins CDC20 and CDH1.
10548110 1999 Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.
10500174 1999 Expression of the CDH1-associated form of the anaphase-promoting complex in postmitotic neurons.
10477750 1999 Human BUBR1 is a mitotic checkpoint kinase that monitors CENP-E functions at kinetochores and binds the cyclosome/APC.
10318877 1999 Characterization of the DOC1/APC10 subunit of the yeast and the human anaphase-promoting complex.
10037602 1999 Function of WW domains as phosphoserine- or phosphothreonine-binding modules.
9736712 1998 Mad2 transiently associates with an APC/p55Cdc complex during mitosis.
9618490 1998 Caspase-dependent activation of cyclin-dependent kinases during Fas-induced apoptosis in Jurkat cells.
9499405 1998 The essential mitotic peptidyl-prolyl isomerase Pin1 binds and regulates mitosis-specific phosphoproteins.
9469815 1998 Identification of a cullin homology region in a subunit of the anaphase-promoting complex.
9405394 1997 The serine/threonine phosphatase PP5 interacts with CDC16 and CDC27, two tetratricopeptide repeat-containing subunits of the anaphase-promoting complex.
8619132 1995 Localization of the human homolog of the yeast cell division control 27 gene (CDC27) proximal to ITGB3 on human chromosome 17q21.3.
8234252 1993 Linking yeast genetics to mammalian genomes: identification and mapping of the human homolog of CDC27 via the expressed sequence tag (EST) data base.
7756179 1995 Identification of a human homologue of yeast nuc2 which interacts with the retinoblastoma protein in a specific manner.
7736578 1995 CDC27Hs colocalizes with CDC16Hs to the centrosome and mitotic spindle and is essential for the metaphase to anaphase transition.