Property Summary

NCBI Gene PubMed Count 86
PubMed Score 84.82
PubTator Score 58.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.145 6.1e-03
atypical teratoid / rhabdoid tumor -2.100 4.4e-06
glioblastoma -2.000 6.3e-04
lung cancer 1.200 6.2e-04
medulloblastoma -1.600 4.4e-04
medulloblastoma, large-cell -2.200 3.3e-06
osteosarcoma -1.905 9.0e-05
ovarian cancer 2.000 8.0e-05
psoriasis -1.900 3.2e-03
ulcerative colitis 1.100 9.3e-06

 GO Function (1)

PDB (13)

Gene RIF (16)

AA Sequence

MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQ      1 - 70
CKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQK     71 - 140
SLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTI    141 - 210
ELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTP    211 - 280
SFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQ    281 - 350
SSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQ    351 - 420
PNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSH    421 - 490
LPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT    491 - 560
DMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRV    561 - 630
NPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDP    631 - 700
KNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKG    701 - 770
ANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF                    771 - 824
//

Text Mined References (97)

PMID Year Title