Property Summary

NCBI Gene PubMed Count 104
PubMed Score 209.24
PubTator Score 166.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.100 1.5e-06
esophageal adenocarcinoma 1.200 2.7e-02
osteosarcoma -1.726 2.3e-05
Atopic dermatitis 1.700 1.2e-05
adrenocortical carcinoma 1.688 4.8e-06
intraductal papillary-mucinous carcinoma... 2.500 7.0e-04
intraductal papillary-mucinous neoplasm ... 1.900 9.8e-04
active Crohn's disease 1.002 1.4e-02
interstitial cystitis 1.400 9.0e-03
Breast cancer 1.600 1.3e-03
gastric carcinoma 1.900 2.8e-02
ulcerative colitis 1.800 7.3e-08
psoriasis 1.600 8.4e-117

 GWAS Trait (1)

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
368 screening 84 / 0 / 65138 Cdc25B Catalytic Domain protein tyrosine phosphatase HTS
443 confirmatory 6 / 0 / 0 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Dose Response Confirmation and Secondary Selectivity/Specificity Assay
569 confirmatory 29 / 0 / 55 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase HTS Dose Response Confirmation Assay
649 confirmatory 14 / 0 / 15 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in 25 mM DTT
650 confirmatory 25 / 0 / 4 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response Reproducibility Assay
668 confirmatory 18 / 0 / 11 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in the presence of Catalase.
669 confirmatory 8 / 0 / 21 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in 25 mM DTT and Catalase.
670 confirmatory 15 / 0 / 14 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in the presence of Beta-Mercaptoethanol.
671 confirmatory 14 / 0 / 15 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in the presence of Glutathione.
676 confirmatory 23 / 0 / 23 MKP-1 Dual Specificity Protein Tyrosine Phosphatase Probe Assessment: Cdc25B Dose Response Selectivity Assay

Gene RIF (65)

PMID Text
26474275 Data indicate that nine compounds were identified with Ki values for CDC25A, -B and -C ranging from 0.01 to 4.4 muM.
25775393 High CDC25B expression is associated with esophageal carcinoma.
25680404 For the first time, we demonstrate that miRNA-211 is a direct negative regulator of CDC25B expression in TNBC cells, alters other related target proteins CCNB1 and FOXM1, and then inhibits breast cancer cells growth, migration, and invasion
25384584 FK-3000 exerts its antiproliferative effect through G2/M cell cycle arrest via downregulation of cyclin B and phospho-CDC2 by p38 MAPK phosphorylation and CDC25B dephosphorylation .
25326518 Our results suggest that expression of CDC25B may be used as a potential prognostic marker in the pathogenesis of retinoblastoma.
24740794 Solution NMR studies reveal no global flexibility in the structure of CDC25b catalytic domain
24344030 Positive expression of CDC25B in astrocytoma affects the prognosis in an adverse manner.
24234332 Cdc25B upregulation and 14-3-3sigma downregulation might promote development of bladder cancer and suggested a poor prognosis.
24109234 CDC25B is a pro-influenza A virus host factor.
23908401 Phosphorylation and inhibition of cdc25B causes delayed progression from G2 into mitosis in melanoma cells.
23840880 CDC25B, through activation of a centrosomal pool of CDK2, stabilises the local pool of Mps1 which in turn regulates the level of centrin 2 at the centrosome.
23708659 RSK promotes G2/M transition in mammalian cells through activating phosphorylation of Cdc25A and Cdc25B.
22721997 Indirubin, an acting component of indigo naturalis, inhibits EGFR activation and EGF-induced CDC25B gene expression in epidermal ke
22631674 downregulation of Cdc25B resulted in slower growth, more G2/M cells, weaker capacity for migration and invasion and induction of apoptosis in renal carcinoma cell line 769-P transfectants; findings suggest an important role of Cdc25B in renal cell carcinoma development
22132193 Transcriptional repression mediated by IER5 regulates Cdc25B expression levels via the release of NF-YB and p300 in acute myeloid leukemia.
21709669 We identified CDC25B as novel miR-148a target which may confer a proliferative advantage in pancreatic ductal adenocarcinomas.
21640712 there are 13 sites phosphorylated by PLK1 in CDC25B.This study illustrates the complexity of the phosphorylation pattern and of the subsequent regulation of CDC25B activity.
21558810 Ser169 phosphorylation can disrupt 14-3-3 binding to Ser151 activating Cdc25B3, providing a mechanism for regulating Cdc25B3 activation without dephosphorylation of the 14-3-3 binding sites.
21363925 Our findings reveal the existence of a previously unrecognized CDC25B isoform that operates specifically in the nucleus to reinitiate G2/M transition after DNA damage
21242964 Deletion and mutation analyses of the Cdc25B promoter revealed that downregulation by p53 is dependent on the presence of functional Sp1/Sp3 and NF-Y binding sites
21091437 CDC25B forms a close association with Ctn-2 proteins at the centrosome.
20956543 Cdc14A phosphatase prevents premature activation of Cdk1 regulating Cdc25A and Cdc25B at the entry into mitosis.
20801879 The mitotic phosphorylation of Ser(321) acts to maintain full activation of Cdc25B by disrupting 14-3-3 binding to Ser(323) and enhancing the dephosphorylation of Ser(323) to block 14-3-3 binding to this site.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20500813 CDC25B a minor role in the pathogenesis and/or progression of vulvar squamous cell carcinomas.
20176018 A new mechanism of CDC25B regulation in response to stress.
20128929 A moderate and unscheduled increase in CDC25B level, as observed in a number of human tumours, is sufficient to overcome the S-phase checkpoint efficiency thus leading to replicative stress and genomic instability.
20025242 Adventitious arsenate reductase activity of the catalytic domain of the human Cdc25B phosphatases.
19801682 MAPK pathway activation delays G2/M progression by destabilizing Cdc25B
19738611 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19638579 Importance of a novel JNK/p38-Cdc25B axis for a nongenotoxic stress-induced cell cycle checkpoint.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19308021 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18635965 This work suggests that the expression level of CDC25B might be a potential key parameter of the cellular response to cancer therapy.
18559558 CDC25B mRNA was overexpressed in 64 of the 73 esophageal squamous cell carcinoma cases evaluated.
18235220 Inhibition of CDC25B by siRNA results in accumulation of cells in G2 phase with two separated centrosomes.
18160429 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
18089784 Abnormal expression of CDC25B in human tumors may have a critical role in centrosome amplification and genomic instability.
18060429 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
17651784 CDC25B might play an important role in the angiogenic process and in determining the prognosis of patients with non-small cell lung carcinoma
17599046 CDC25B splice variants have differential mitotic stabilities, a feature that is likely to have major consequences on the local control of cyclin-dependent kinase-cyclin activities during mitotic progression.
17591782 Cdc25B, but not Cdc25C, is capable of inhibiting cellular proliferation in a manner dependent upon its catalytic activity
17548358 p38 regulates the timing of mitotic entry via modulation of Cdc25B activity under normal nonstress conditions
17336969 The expression of CDC25B in different cellular compartments of human spermatozoa suggests that there are diverse noncell-cycle-related functions of CDC25B in terminally differentiated human germ cells.
17106257 Chk1 functions to coordinate mitotic events through regulation of Cdc25B
17018577 Caulibugulone inhibition of cellular Cdc25A and B phosphatases occurred through at least two different mechanisms, leading to pronounced cell cycle arrest.
17003105 Results show under normal cell cycle conditions and in the absence of DNA damage, CDC25B is constitutively phosphorylated by CHK1 during interphase and thus prevents the premature initiation of mitosis.
16861915 MAPKAP kinase-2 phosphorylates CDC25B on multiple sites including S169, S323, S353 and S375, while p38SAPK phosphorylates CDC25B on S249.
16082213 Aurora-A-mediated phosphorylation of CDC25B at the centrosome is an important step contributing to the earliest events inducing mitosis, upstream of CDK1-cyclin B1 activation
15908796 These results support a model in which pEg3 contributes to the control of progression through mitosis by phosphorylation of the CDC25 phosphatases.
15550849 Results suggest that cdc25B is important especially in the early phase of breast carcinoma progression.
15456846 Cdc25B localisation and nuclear export changes during the cell cycle and in response to stress
15173315 14-3-3 subtypes can control the subcellular localization of CDC25B by binding to a specific site.
15128871 Phosphorylation of CDC25B by AURA at the centrosome contributes to the G2-M transition.
15003534 Identification of a nuclear export signal in CDC25B.
14767575 cdc25B plays a role in the early phase of thyroid lymphoma possibly including the malignant transformation from chronic thyroiditis
14559803 Cdc25B may play important roles in the development and progression of endometrioid endometrial carcinoma and clear cell carcinoma and uterine pappillary serous carcinoma by different mechanism.
12681290 Data show that FHL3 (human four-and-a-half LIM-only protein 3) interacts with human phosphatase CDC25B in the cell nucleus.
12569365 upregulation of Cdc25B in human prostate cancer and its interplay with androgen receptor may contribute to prostate cancer development
12527891 we demonstrate that phosphorylation of CDC25B by protein kinase CK2 increases the catalytic activity of the phosphatase in vitro as well as in vivo.CDC25B interacts with CK2, and this interaction, mediated by the CK2beta regulatory subunit
12400006 pEg3 kinase is able to specifically phosphorylate CDC25B in vitro. One phosphorylation site was identified and corresponded to serine 323
12107172 nuclear localization and serine 146 integrity required for induction of mitosis

AA Sequence

MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMHDLAGLGSETP      1 - 70
KSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIR     71 - 140
NEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFKMPWKPTHPSS    141 - 210
THALAEWASRREAFAQRPSSAPDLMCLSPDRKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLK    211 - 280
DDDAVPPGMESLISAPLVKTLEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKR    281 - 350
RRSVTPPEEQQEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM    351 - 420
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHCEFS    421 - 490
SERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLK    491 - 560
TRSWAGERSRRELCSRLQDQ                                                      561 - 580
//

Text Mined References (109)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26474275 2015 Ligand-based chemoinformatic discovery of a novel small molecule inhibitor targeting CDC25 dual specificity phosphatases and displaying in vitro efficacy against melanoma cells.
25775393 2015 Expression and significance of CDC25B, PED/PEA-15 in esophageal carcinoma.
25680404 2015 MicroRNA-211, a direct negative regulator of CDC25B expression, inhibits triple-negative breast cancer cells' growth and migration.
25384584 2015 6,7-di-O-acetylsinococuline (FK-3000) induces G2/M phase arrest in breast carcinomas through p38 MAPK phosphorylation and CDC25B dephosphorylation.
25326518 2015 Expression of CDC25A and CDC25B phosphatase proteins in human retinoblastoma and its correlation with clinicopathological parameters.
24740794 2014 Solution NMR studies reveal no global flexibility in the catalytic domain of CDC25B.
24344030 CDC25B, Ki-67, and p53 expressions in reactive gliosis and astrocytomas.
24234332 2014 High expression of Cdc25B and low expression of 14-3-3? is associated with the development and poor prognosis in urothelial carcinoma of bladder.
24109234 2013 Targeting cell division cycle 25 homolog B to regulate influenza virus replication.
23908401 2013 MC1R and cAMP signaling inhibit cdc25B activity and delay cell cycle progression in melanoma cells.
23840880 2013 CDC25B overexpression stabilises centrin 2 and promotes the formation of excess centriolar foci.
23708659 2014 RSK promotes G2/M transition through activating phosphorylation of Cdc25A and Cdc25B.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160377 2013 Doxorubicin promotes transcriptional upregulation of Cdc25B in cancer cells by releasing Sp1 from the promoter.
22721997 2012 Indirubin, an acting component of indigo naturalis, inhibits EGFR activation and EGF-induced CDC25B gene expression in epidermal keratinocytes.
22631674 2012 Knockdown of Cdc25B in renal cell carcinoma is associated with decreased malignant features.
22318230 2012 The CDC25B phosphatase shortens the G2 phase of neural progenitors and promotes efficient neuron production.
22132193 2011 Transcriptional repression of Cdc25B by IER5 inhibits the proliferation of leukemic progenitor cells through NF-YB and p300 in acute myeloid leukemia.
21709669 2011 MicroRNA-148a is down-regulated in human pancreatic ductal adenocarcinomas and regulates cell survival by targeting CDC25B.
21640712 2011 Study of the docking-dependent PLK1 phosphorylation of the CDC25B phosphatase.
21558810 2011 Phosphorylation of Cdc25B3 Ser169 regulates 14-3-3 binding to Ser151 and Cdc25B activity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21363925 2011 Identification of N-terminally truncated stable nuclear isoforms of CDC25B that are specifically involved in G2/M checkpoint recovery.
21254220 2011 Propensity score-based nonparametric test revealing genetic variants underlying bipolar disorder.
21242964 2011 Cdc25B is negatively regulated by p53 through Sp1 and NF-Y transcription factors.
21091437 2011 CDC25B associates with a centrin 2-containing complex and is involved in maintaining centrosome integrity.
20956543 2010 Human Cdc14A phosphatase modulates the G2/M transition through Cdc25A and Cdc25B.
20801879 2010 Mitotic phosphorylation of Cdc25B Ser321 disrupts 14-3-3 binding to the high affinity Ser323 site.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20500813 2010 Overexpression of CDC25B, CDC25C and phospho-CDC25C (Ser216) in vulvar squamous cell carcinomas are associated with malignant features and aggressive cancer phenotypes.
20176018 2010 UV-induced downregulation of the CDC25B protein in human cells.
20128929 2010 Unscheduled expression of CDC25B in S-phase leads to replicative stress and DNA damage.
20025242 2010 Adventitious arsenate reductase activity of the catalytic domain of the human Cdc25B and Cdc25C phosphatases.
19801682 2009 MAPK pathway activation delays G2/M progression by destabilizing Cdc25B.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19638579 2009 Stress-activated mitogen-activated protein kinases c-Jun NH2-terminal kinase and p38 target Cdc25B for degradation.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19308021 2009 Findings from bipolar disorder genome-wide association studies replicate in a Finnish bipolar family-cohort.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18635965 2008 Moderate variations in CDC25B protein levels modulate the response to DNA damaging agents.
18559558 2008 Overexpression of CDC25B and LAMC2 mRNA and protein in esophageal squamous cell carcinomas and premalignant lesions in subjects from a high-risk population in China.
18235220 2008 Asymmetric localization of the CDC25B phosphatase to the mother centrosome during interphase.
18089784 2007 CDC25B involvement in the centrosome duplication cycle and in microtubule nucleation.
17651784 2007 CDC25B: relationship with angiogenesis and prognosis in non-small cell lung carcinoma.
17599046 2007 Differential mitotic degradation of the CDC25B phosphatase variants.
17591782 2007 The dual specificity phosphatase Cdc25B, but not the closely related Cdc25C, is capable of inhibiting cellular proliferation in a manner dependent upon its catalytic activity.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
17548358 2007 A functional role for p38 MAPK in modulating mitotic transit in the absence of stress.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17336969 2007 Expression of various CDC25B isoforms in human spermatozoa.
17332740 2007 Rho GTPases regulate PRK2/PKN2 to control entry into mitosis and exit from cytokinesis.
17106257 2006 Chk1-dependent regulation of Cdc25B functions to coordinate mitotic events.
17018577 2007 Independent mechanistic inhibition of cdc25 phosphatases by a natural product caulibugulone.
17003105 2006 CHK1 phosphorylates CDC25B during the cell cycle in the absence of DNA damage.
16861915 2006 CDC25B phosphorylation by p38 and MK-2.
16672277 2006 Amino acids C-terminal to the 14-3-3 binding motif in CDC25B affect the efficiency of 14-3-3 binding.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16082213 2005 CDC25B phosphorylation by Aurora-A occurs at the G2/M transition and is inhibited by DNA damage.
15908796 2005 CDC25B phosphorylated by pEg3 localizes to the centrosome and the spindle poles at mitosis.
15629715 2005 MAPKAP kinase-2 is a cell cycle checkpoint kinase that regulates the G2/M transition and S phase progression in response to UV irradiation.
15550849 2004 Expression of cdc25A and cdc25B phosphatase in breast carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456846 2004 Characterisation of Cdc25B localisation and nuclear export during the cell cycle and in response to stress.
15311285 2004 Centrosome-associated Chk1 prevents premature activation of cyclin-B-Cdk1 kinase.
15173315 2004 Binding of 14-3-3beta but not 14-3-3sigma controls the cytoplasmic localization of CDC25B: binding site preferences of 14-3-3 subtypes and the subcellular localization of CDC25B.
15150265 2004 Human SAD1 kinase is involved in UV-induced DNA damage checkpoint function.
15128871 2004 Phosphorylation of CDC25B by Aurora-A at the centrosome contributes to the G2-M transition.
15003534 2004 Nuclear export signal in CDC25B.
14767575 2004 Cdc25A and cdc25B expression in malignant lymphoma of the thyroid: correlation with histological subtypes and cell proliferation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559803 2003 Coordinate expression of Cdc25B and ER-alpha is frequent in low-grade endometrioid endometrial carcinoma but uncommon in high-grade endometrioid and nonendometrioid carcinomas.
12871587 2003 Interaction of 14-3-3 with Bid during seizure-induced neuronal death.
12766774 2003 Dual phosphorylation controls Cdc25 phosphatases and mitotic entry.
12764136 2003 14-3-3 acts as an intramolecular bridge to regulate cdc25B localization and activity.
12681290 2003 LIM-only protein FHL3 interacts with CDC25B2 phosphatase.
12569365 2003 Overexpression of Cdc25B, an androgen receptor coactivator, in prostate cancer.
12527891 2003 Protein kinase CK2 regulates CDC25B phosphatase activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12400006 2002 Human pEg3 kinase associates with and phosphorylates CDC25B phosphatase: a potential role for pEg3 in cell cycle regulation.
12107172 2002 Nuclear localization of CDC25B1 and serine 146 integrity are required for induction of mitosis.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11689696 2001 Cdc25B functions as a novel coactivator for the steroid receptors.
11333986 2001 Initiation of a G2/M checkpoint after ultraviolet radiation requires p38 kinase.
10822367 2000 Regulation of CDC25B phosphatases subcellular localization.
10740819 2000 Cell cycle regulation by the Cdc25 phosphatase family.
10713667 2000 Specific interaction between 14-3-3 isoforms and the human CDC25B phosphatase.
10543950 1999 Crystal structure of the catalytic subunit of Cdc25B required for G2/M phase transition of the cell cycle.
10444066 1999 Cdc25B and Cdc25C differ markedly in their properties as initiators of mitosis.
10403798 1999 Multiple splicing variants of cdc25B regulate G2/M progression.
9733650 1998 A model of Cdc25 phosphatase catalytic domain and Cdk-interaction surface based on the presence of a rhodanese homology domain.
9585407 1998 Nuclear localization of cyclin B1 controls mitotic entry after DNA damage.
9278511 1997 Conservation of the Chk1 checkpoint pathway in mammals: linkage of DNA damage to Cdk regulation through Cdc25.
9268380 1997 Human Myt1 is a cell cycle-regulated kinase that inhibits Cdc2 but not Cdk2 activity.
9188863 1997 Alternative splicing of the human CDC25B tyrosine phosphatase. Possible implications for growth control?
9141461 1997 Cdc25 protein phosphatases in cell proliferation.
8468065 1993 The human cell cycle gene CDC25B is located at 20p13.
8440392 1993 Dephosphorylation of human p34cdc2 kinase on both Thr-14 and Tyr-15 by human cdc25B phosphatase.
8276402 1993 Chromosome mapping of human CDC25A and CDC25B phosphatases.
7667636 1995 CDC25 phosphatases as potential human oncogenes.
7644510 1995 14-3-3 proteins associate with cdc25 phosphatases.
1836978 1991 Specific activation of cdc25 tyrosine phosphatases by B-type cyclins: evidence for multiple roles of mitotic cyclins.
1828290 1991 Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein.
1662986 1991 An additional homolog of the fission yeast cdc25+ gene occurs in humans and is highly expressed in some cancer cells.