Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.05
PubTator Score 1.00

Knowledge Summary

Patent

No data available

AA Sequence

MNEVSSECGKKCEPLGCSSTNGDLQGEAGAVVSIFLRMVPRIKSNEGYGYSNRNWRKENTMHSLDRNIVD      1 - 70
GGQALGQWKRKSKGRSSWAAAPHCSPRCSLTSQGVKKMRSSTLQDPRRRDPQDDVYVDITDRLRFAILYS     71 - 140
RPKSASNVHYFSIDNELEYENFSEDFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAA    141 - 210
FLVGCYMVIYLGRTPEAAYRILIFGDTPYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLD    211 - 280
EYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRF    281 - 350
TDAGFDHHDLFFADGSTPTDAIVKRFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAW    351 - 420
VRICRPGLVIGPQQQFLVMKQTSLWLEGDYFRQRLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEP    421 - 490
KPYSDDDEINGVTQGDRSRALKRRRQSKTNDILLPSPLAVLTFTLCSVVIWWIVCDYILPILLF          491 - 554
//

Text Mined References (8)

PMID Year Title