Property Summary

NCBI Gene PubMed Count 96
PubMed Score 449.42
PubTator Score 709.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis -1.400 1.6e-02
astrocytoma 2.000 3.0e-03
ependymoma 2.300 1.1e-02
oligodendroglioma 2.100 2.6e-02
psoriasis -1.100 3.9e-02
glioblastoma multiforme 2.300 2.2e-27
osteosarcoma 1.136 4.2e-02
atypical teratoid / rhabdoid tumor 1.100 4.2e-03
Duchenne muscular dystrophy 1.050 3.4e-11
limb girdle muscular dystrophy 2A 1.122 2.1e-07
pancreatic ductal adenocarcinoma liver m... -2.171 1.8e-02
intraductal papillary-mucinous adenoma (... -1.900 4.3e-04
intraductal papillary-mucinous neoplasm ... -1.500 1.5e-02
lung cancer -1.800 3.2e-05
pediatric high grade glioma 2.100 1.9e-07
pilocytic astrocytoma 1.400 1.0e-04
lung carcinoma -2.000 3.7e-22
Breast cancer 1.800 2.5e-06
ovarian cancer -2.400 1.0e-07
pituitary cancer -2.200 6.5e-05
Down syndrome 1.800 1.0e-03

 GO Process (1)

Gene RIF (63)

PMID Text
26522646 Data show that CD99 antigen expression increased during in vitro differentiation of germinal center B cells and was highest in plasma cells (PCs).
26172215 CD99 can suppress CD98-mediated assembly of pro-tumorigenic signaling complexes through its ability to dephosphorylate focal adhesion kinase.
26000982 These results suggest that SEPTIN2-mediated cytoskeletal rearrangement and STATHMIN-mediated differentiation may contribute to changes in cell morphology and differentiation of H/RS cells with CD99 upregulation in Hodgkin lymphoma.
26000312 The results highlight an important role of CD99 in the differentiation and activity of human osteoblasts in physiological and pathological conditions.
25957287 Our results suggest that the CD34/CD25/CD123/CD99(+) LAIP is strictly associated with FLT3-ITD-positive cells.
25501132 The dAbd C7 induced rapid and massive EWS cell death through Mdm2 degradation and p53 reactivation. Mdm2 overexpression as well as silencing of p53 in p53wt EWS cells decreased CD99-induced EWS cell death
24798881 Report purification of human antibody scFv anti-CD99 for blocking monocyte transendothelial migration.
24797829 CD99 expression in astrocytomas of different malignant grades might contribute to the infiltrative ability and support the importance of CD99 as a potential target to reduce infiltrative astrocytoma capacity in migration and invasion.
24702676 CD99 expression in nasal lobular capillary haemangioma.
24677094 CD99 induces ERK activation, increasing its membrane-bound/cytoplasmic form rather than affecting its nuclear localization.
24341229 It is assumed that the expression of CD99 plays an important role in the pathogenesis of psoriasis, in the processes of emigration of leukocytes, and in their tropism toward to the epidermis
24247571 dermatofibromastrongly expresses CD99 in a diffuse pattern that may serve as evidence in distinction from dermatofibrosarcoma
24094957 Solid pseudopapillary neoplasm of the pancreas exhibits a very unique immunostaining pattern for CD99 that is present in all cases.
23743627 CXCL16, inversely correlated with CD99 expression in Hodgkin Reed-Sternberg (H/RS) cells.
23644663 we have shown that forced expression of wild-type CD99 in osteosarcoma cells induces downregulation of genes such as ROCK2
23333754 PVR resides in the recently identified lateral border recycling compartment, similar to PECAM and CD99.
23152061 CD99-induced HSP70 expression in B and T lymphocytes.
23145531 We report an unusual pattern of paranuclear dot-like expression of CD99 in 14 cases of Merkel cell carcinoma, two of which did not express CK20.
22986530 we show that miR-30a-5p provides an essential link between EWS-FLI1 and CD99, two major biomarkers in Ewing sarcoma
22864685 Data suggest that CD99 expression in lymph node/germinal center biopsies at time of diagnosis is not prognostic marker for survival in patients with diffuse large B-cell lymphoma treated with rituximab-CHOP immunochemotherapy.
22781601 CD99 is highly expressed in anaplastic large-cell lymphoma, and showed high rate of co-expression with ALK.
22392539 the membrane protein CD99 was identified as a novel stromal factor with clinical relevance. The results support the concept that stromal properties have an important impact on tumour progression.
22335486 The new antibody scFvC7 recognizes the CD99 extracellular domain.
22189791 Platelet endothelial cell adhesion molecule-1 (PECAM-1/CD31) and CD99 are critical in lymphatic transmigration of human dendritic cells.
22083306 NF-kappaB2 exhibits the major inhibitory role in the transcription at the CD99 promoter
22020966 upregulation of CD99 in H/RS cells induces terminal B-cell differentiation, which may provide a novel therapeutic strategies for cHL
21775056 Data show that CD99 combined with E-cadherin/beta-catenin and CD10 can be used as a relatively specific expression profile of SPTs.
21566515 Our study has identified for the first time that pancreatic solid-pseudopapillary neoplasm exhibits a unique dot-like staining pattern for CD99.
21267687 High CD99 is associated with central primitive neuroectodermal tumors and Ewing's sarcoma
21196719 CD99 positivity was significantly associated with advanced stage (p < 0.01), higher risk group according to the International Prognostic Index risk score (p < 0.01) and non-germinal center B cell-like type (p = 0.01).
20453109 CD99 may play a physiologic role in the clonal deletion processes necessary for B-lymphoid selection
20217126 Protein expression and gene promoter hypermethylation of CD99 in transitional cell carcinoma of urinary bladder
20197622 Analysis of a panel of human EWS cells revealed an inverse correlation between CD99 and H-neurofilament expression, as well as an inverse correlation between neural differentiation and oncogenic transformation.
20184665 CD99 showed no preferential staining of Atypical fibroxanthoma, spindle cell malignant melanoma or sarcomatoid carcinoma/spindle cell squamous cell carcinoma
19901887 Type B3 thymic epithelial tumor in an adolescent detected by immunohistochemical staining for CD5, CD99, and KIT (CD117): a case report.
19723899 Observational study of gene-disease association. (HuGE Navigator)
19307784 CD99 plays a critical role in human monocyte and lymphocyte transendothelial migration across pocine endothelial cells.
19289593 CD99 is frequently expressed in anaplastic large cell lymphoma
18849489 CD99 also binds p230/golgin-245, a coiled-coil protein that recycles between the cytosol and buds/vesicles of the TGN and which plays a fundamental role in trafficking transport vesicles.
18552083 CD99-immunohistochemistry is unique in that it is helpful for the diagnosis of clear cell brain tumors through the visualization of CD99-negative clear cells
17652531 CK19/CD99 immunoexpression did not correlate with extent of tumor invasion, mitotic activity, Ki-67 labeling index, presence of extracellular mucinous pools dissecting muscle, and angiolymphatic and perineural/neural invasion in goblet cell carcinoids.
17471235 Our findings highlight the involvement of CD99 in crucial processes of cancer malignancy.
17464179 These data demonstrate the unique properties of CD99 co-stimulation that distinguish this molecule from CD28 and other raft-resident co-stimulatory factors.
17202377 PECAM (CD31) and CD99 regulate distinct, sequential steps in the transendothelial migration of neutrophils during inflammation
16984917 The results of this study suggest that expression of a splice variant of CD99 contributes to the invasive ability of human breast cancer cells by up-regulating AP-1-mediated gene expression through the Akt-dependent ERK and JNK signaling pathways.
16825498 subsets of CD34+ cells with high or low levels of CD99 expression produce different numbers of erythroid, natural killer (NK), or dendritic cells in the in vitro differentiation assays
16614706 LMP-1 induced down-regulation of the CD99 pathway is important in nasopharyngeal carcinogenesis, and the expression of CD99 in lymphoid stroma may regulate immune response to nasopharyngeal carcinoma.
16614706 LMP-1 induced down-regulation of the CD99 pathway is important in nasopharyngeal carcinogenesis, and the expression of CD99 in lymphoid stroma may regulate immune response to nasopharyngeal carcinoma. (LMP-1= EBV latent membrane protein 1)
16421247 The findings point to an antioncogenic role for CD99 in osteosarcoma, likely through the regulation of caveolin-1 and inhibition of c-Src kinase activity.
16361803 High expression of CD99 in ALK-positive anaplastic large cell lymphomas is an unexpected finding and its biologic and clinical significance has yet to be clarified.
15716602 CD99 was found to be widely expressed in both sarcomatous and carcinoma component in pleomorphic carcinomas of the lung
15528994 Cooperation of CD99 engagement with suboptimal TCR/CD3 signals resulted in enhanced CD4+ T cell proliferation, elevated expression of CD25 and GM1, increased apoptosis, augmented activation of JNK, and increased AP-1 activation
15469477 loss of CD99 expression in PETs was found to be associated with ominous prognostic indicators
15388255 cyclophilin A binds CD99 and may be either a signaling mediator or a signaling regulator for CD99
15359120 solution structure of cytoplasmic domain of human CD99 type I shows that it has a hairpin shape anchored by two flexible loops
15184883 our findings indicate that CD99 functions occur through reorganization of cytoskeleton and identify actin and zyxin as the early signaling events driven by CD99 engagement.
14744088 Solitary sclerotic fibroma is a fibrotic lesion with cells positive for CD34 and O13. O13 expression in SF has not been previously described.
14646598 CD99 type II acts as a negative regulator in the neural differentiation of precursor cells that might occur during nerve system development
14623115 CD99 epitopes plays a distinct role in T cell biology, especially in T cell apoptosis.
12832073 inhibition by MHC class I engagement or apoptosis and upregulation of T cell receptor and MHC molecules in human thymocytes and T cell line induced by CD99
12681511 engagement triggers the exocytic transport of ganglioside GM1 and the reorganization of actin cytoskeleton
12216109 Functional involvement of src and focal adhesion kinase in a CD99 splice variant-induced motility of human breast cancer cells
12172043 Results suggest that type I is the major isoform of CD99 expressed in non-neoplastic gastric mucosa and gastric adenocarcinomas.

AA Sequence

MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPP      1 - 70
NPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAG     71 - 140
AISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK                             141 - 185
//

Text Mined References (101)

PMID Year Title
26522646 2015 CD99 regulates CXCL12-induced chemotaxis of human plasma cells.
26172215 2015 CD99 inhibits CD98-mediated ?1 integrin signaling through SHP2-mediated FAK dephosphorylation.
26000982 2015 SEPTIN2 and STATHMIN Regulate CD99-Mediated Cellular Differentiation in Hodgkin's Lymphoma.
26000312 2015 Human myeloma cell lines induce osteoblast downregulation of CD99 which is involved in osteoblast formation and activity.
25957287 2015 A Leukemia-Associated CD34/CD123/CD25/CD99+ Immunophenotype Identifies FLT3-Mutated Clones in Acute Myeloid Leukemia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25501132 2015 CD99 triggering in Ewing sarcoma delivers a lethal signal through p53 pathway reactivation and cooperates with doxorubicin.
24798881 2014 Blocking monocyte transmigration in in vitro system by a human antibody scFv anti-CD99. Efficient large scale purification from periplasmic inclusion bodies in E. coli expression system.
24797829 2014 CD99 is upregulated in placenta and astrocytomas with a differential subcellular distribution according to the malignancy stage.
24702676 2014 CD99 expression in nasal lobular capillary haemangioma.
24677094 2014 CD99 drives terminal differentiation of osteosarcoma cells by acting as a spatial regulator of ERK 1/2.
24341229 [Characteristics of CD99 expression in the skin of psoriasis patients].
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247571 2014 CD99 expression in dermatofibrosarcoma protuberans and dermatofibroma.
24094957 2013 Solid pseudopapillary neoplasm of the pancreas in children: a 15-year experience and the identification of a unique immunohistochemical marker.
23743627 2013 CXC chemokine ligand 16, inversely correlated with CD99 expression in Hodgkin Reed-Sternberg cells, is widely expressed in diverse types of lymphomas.
23644663 2014 CD99 suppresses osteosarcoma cell migration through inhibition of ROCK2 activity.
23333754 2013 Poliovirus receptor (CD155) regulates a step in transendothelial migration between PECAM and CD99.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152061 2012 CD99 ligation upregulates HSP70 on acute lymphoblastic leukemia cells and concomitantly increases NK cytotoxicity.
23145531 2013 CD99 expression in Merkel cell carcinoma: a case series with an unusual paranuclear dot-like staining pattern.
22986530 2013 MiR-30a-5p connects EWS-FLI1 and CD99, two major therapeutic targets in Ewing tumor.
22864685 2012 CD99 expression and newly diagnosed diffuse large B-cell lymphoma treated with rituximab-CHOP immunochemotherapy.
22781601 2012 [Co-expression of CD99/MIC2 and ALK in anaplastic large-cell lymphoma tissues and its significance].
22392539 2012 CD99 is a novel prognostic stromal marker in non-small cell lung cancer.
22335486 2013 Generation of human single-chain antibody to the CD99 cell surface determinant specifically recognizing Ewing's sarcoma tumor cells.
22189791 2012 Platelet endothelial cell adhesion molecule-1 (PECAM-1/CD31) and CD99 are critical in lymphatic transmigration of human dendritic cells.
22083306 2011 Nuclear factor-?B2 represses Sp1-mediated transcription at the CD99 promoter.
22020966 2012 CD99 triggers upregulation of miR-9-modulated PRDM1/BLIMP1 in Hodgkin/Reed-Sternberg cells and induces redifferentiation.
21775056 2011 Immunohistochemical evaluation of solid pseudopapillary tumors of the pancreas: the expression pattern of CD99 is highly unique.
21566515 2011 Paranuclear dot-like immunostaining for CD99: a unique staining pattern for diagnosing solid-pseudopapillary neoplasm of the pancreas.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21267687 2011 The evaluation of CD99 immunoreactivity and EWS/FLI1 translocation by fluorescence in situ hybridization in central PNETs and Ewing's sarcoma family of tumors.
21196719 2011 Clinicopathologic characteristics of CD99-positive diffuse large B-cell lymphoma.
20479283 2010 CD99 and CD99L2 act at the same site as, but independently of, PECAM-1 during leukocyte diapedesis.
20453109 2010 Death induction by CD99 ligation in TEL/AML1-positive acute lymphoblastic leukemia and normal B cell precursors.
20217126 2011 Protein expression and gene promoter hypermethylation of CD99 in transitional cell carcinoma of urinary bladder.
20197622 2010 CD99 inhibits neural differentiation of human Ewing sarcoma cells and thereby contributes to oncogenesis.
20184665 2010 CD10, p63 and CD99 expression in the differential diagnosis of atypical fibroxanthoma, spindle cell squamous cell carcinoma and desmoplastic melanoma.
19901887 2009 Type B3 thymic epithelial tumor in an adolescent detected by immunohistochemical staining for CD5, CD99, and KIT (CD117): a case report.
19723899 2009 Association of the X-chromosomal genes TIMP1 and IL9R with rheumatoid arthritis.
19307784 2009 Human leukocyte transmigration across Galalpha(1,3)Gal-negative porcine endothelium is regulated by human CD18 and CD99.
19289593 2009 Frequent expression of CD99 in anaplastic large cell lymphoma: a clinicopathologic and immunohistochemical study of 160 cases.
18849489 2009 Regulation of HLA class I surface expression requires CD99 and p230/golgin-245 interaction.
18552083 Olig2 and CD99 are useful negative markers for the diagnosis of brain tumors.
17652531 2007 CK19 and CD99 immunoexpression profile in goblet cell (mucin-producing neuroendocrine tumors) and classical carcinoids of the vermiform appendix.
17471235 2007 CD99 isoforms dictate opposite functions in tumour malignancy and metastases by activating or repressing c-Src kinase activity.
17464179 2007 CD99 activates T cells via a costimulatory function that promotes raft association of TCR complex and tyrosine phosphorylation of TCR zeta.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17202377 2007 CD99 is a key mediator of the transendothelial migration of neutrophils.
16984917 2006 A splice variant of CD99 increases motility and MMP-9 expression of human breast cancer cells through the AKT-, ERK-, and JNK-dependent AP-1 activation signaling pathways.
16825498 2006 CD99 expressed on human mobilized peripheral blood CD34+ cells is involved in transendothelial migration.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16614706 2006 The association between CD99 and LMP-1 expression in nasopharyngeal carcinoma.
16421247 2006 CD99 acts as an oncosuppressor in osteosarcoma.
16361803 2005 Immunoreactivity of CD99 in non-Hodgkin's lymphoma: unexpected frequent expression in ALK-positive anaplastic large cell lymphoma.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15716602 2005 Expression of CD99 in pleomorphic carcinomas of the lung.
15528994 2004 CD99 costimulation up-regulates T cell receptor-mediated activation of JNK and AP-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469477 2004 Prevalence of CD99 protein expression in pancreatic endocrine tumours (PETs).
15388255 2004 Identification of cyclophilin A as a CD99-binding protein by yeast two-hybrid screening.
15359120 2004 Solution structure of the cytoplasmic domain of human CD99 type I.
15184883 2004 Molecular mechanisms of CD99-induced caspase-independent cell death and cell-cell adhesion in Ewing's sarcoma cells: actin and zyxin as key intracellular mediators.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14744088 2003 Solitary sclerotic fibroma of skin: a possible link with pleomorphic fibroma with immunophenotypic expression for O13 (CD99) and CD34.
14646598 2003 CD99 type II is a determining factor for the differentiation of primitive neuroectodermal cells.
14623115 2003 The CD99 signal enhances Fas-mediated apoptosis in the human leukemic cell line, Jurkat.
12832073 2003 MHC class II engagement inhibits CD99-induced apoptosis and up-regulation of T cell receptor and MHC molecules in human thymocytes and T cell line.
12681511 2003 Engagement of CD99 triggers the exocytic transport of ganglioside GM1 and the reorganization of actin cytoskeleton.
12526082 2002 Characterization and epitope mapping of two monoclonal antibodies against human CD99.
12508122 2002 CD 99 and CD 106 (VCAM-1) in human testis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12216109 2002 Functional involvement of src and focal adhesion kinase in a CD99 splice variant-induced motility of human breast cancer cells.
12172043 2002 Immunoreactivity of CD99 in stomach cancer.
11290771 2001 CD99 signals caspase-independent T cell death.
10941840 2000 Quantitative analysis of XG blood group and CD99 antigens on human red cells.
10688843 2000 A study of the coregulation and tissue specificity of XG and MIC2 gene expression in eukaryotic cells.
9720506 1998 CD99, keratin, and vimentin staining of sex cord-stromal tumors, normal ovary, and testis.
9670951 1998 Engagement of CD99 induces up-regulation of TCR and MHC class I and II molecules on the surface of human thymocytes.
9278313 1997 CD99 (MIC2) regulates the LFA-1/ICAM-1-mediated adhesion of lymphocytes, and its gene encodes both positive and negative regulators of cellular adhesion.
7506950 1994 Flow cytometric assessment of human MIC2 expression in bone marrow, thymus, and peripheral blood.
7464908 1981 A human quantitative polymorphism related to Xg blood groups.
6540985 1984 The cell surface antigen locus, MIC2X, escapes X-inactivation.
6188056 1983 Genetic evidence that a Y-linked gene in man is homologous to a gene on the X chromosome.
4065101 1985 Biochemical analysis of an antigen produced by both human sex chromosomes.
4058580 1985 Homologous expressed genes in the human sex chromosome pairing region.
4038849 1985 Genes controlling gp25/30 cell-surface molecules map to chromosomes X and Y and escape X-inactivation.
3502698 1987 Recombination between the X and Y chromosomes: implications for the relationship between MIC2, XG and YG.
3472717 1986 Molecular genetics of MIC2: a gene shared by the human X and Y chromosomes.
3460334 1986 Fine mapping of the distal short arm of the human X chromosome using X/Y translocations.
3442403 1986 The 12E7 red cell quantitative polymorphism: control by the Y-borne locus, Yg.
2934738 1986 Cloning an expressed gene shared by the human sex chromosomes.
2894395 1988 A T cell surface molecule different from CD2 is involved in spontaneous rosette formation with erythrocytes.
2877492 1986 A pseudoautosomal gene in man.
2479542 1989 The E2 antigen, a 32 kd glycoprotein involved in T-cell adhesion processes, is the MIC2 gene product.
2465491 1989 The MIC2 gene product: epitope mapping and structural prediction analysis define an integral membrane protein.
2456574 1988 Absence of methylation of a CpG-rich region at the 5' end of the MIC2 gene on the active X, the inactive X, and the Y chromosome.
1695726 1990 Overexpression of the pseudoautosomal gene MIC2 in Ewing's sarcoma and peripheral primitive neuroectodermal tumor.