Property Summary

NCBI Gene PubMed Count 59
PubMed Score 52.22
PubTator Score 70.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

PMID Text
26387756 CD93 expression identifies a predominantly cycling, non-quiescent leukemia-initiating cell population in MLL-rearranged AML, providing opportunities for selective targeting and eradication of LSCs.
26363010 CD93 is a key regulator of glioma angiogenesis and vascular function, acting via cytoskeletal rearrangements required for cell-cell and cell-matrix adhesion.
26008729 The T/T genotype of SNP rs2749817 of CD93 is associated with disseminated cancer.
25288439 These data support a mechanism whereby gC1qR plays an important role in HPV-16 E2-induced human cervical squamous carcinoma cell apoptosis via a mitochondria-dependent pathway.
24807719 Antibody-dependent enhancement of parvovirus B19 involves an alternative mechanism mediated by the heat-sensitive complement factor C1q and its receptor, CD93.
24033555 Expression of CD93 on the lymphocyte population of peripheral blood cells from infants at 1 month after birth was also significantly decreased, compared with that for neonatal umbilical cord blood.
23651874 HPV 16 E2 induces apoptosis by silencing the gC1qR gene or inhibiting p38 MAPK/JNK signalling in cervical squamous cell carcinoma
23272129 soluble EGF-like domain containing CD93 protein is a novel angiogenic factor acting on the endothelium
23268996 These data support a mechanism whereby gC1qR induces apoptosis through the mitochondrial and p53-dependent pathways in cervical squamous cell carcinoma.
23052251 The data indicate that gC1qR inhibits viability, migration and proliferation of cervical squamous cells carcinoma via the p38 MAPK signalling pathway.
22206251 [review] Following a comprehensive summary of CD93 expression patterns, this review focuses on recent findings that address the putative function of CD93 in inflammation and innate immunity.
21768350 Data show that Pic, a class 2 SPATE protein produced by Shigella flexneri 2a targets a broad range of human leukocyte glycoproteins including CD43, CD44, CD45, CD93, CD162 and the surface-attached chemokine fractalkine.
21332844 Results suggest that the plasma concentration of soluble CD93 is a potential novel biomarker for Coronary Artery Disease (CAD), including MI.
20512406 expression on naive T lymphocytes (CD4(+)CD45RA (+) cells) in human neonatal umbilical cord blood
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19796797 both B1 receptor and gC1q receptor are involved in the vascular leakage induced by hereditary and acquired angioedema plasma.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19372141 Observational study of gene-disease association. (HuGE Navigator)
19344414 Observational study of gene-disease association. (HuGE Navigator)
19166692 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18834607 RNAi-mediated suppression of gC1qR/p32 markedly reduced HTNV binding and infection in human lung epithelial A549 cells
18599554 Observational study of gene-disease association. (HuGE Navigator)
18094537 Taken together, these findings indicate that the expression of the CD93 molecule identified by CD93 mAb (mNI-11) is dramatically decreased on U937 cells with apoptotic properties
12891708 O-glycosylation is important in the stable cell surface expression of C1qRP/CD93
12140365 C1qRp defines a new human stem cell population with hematopoietic and hepatic potential
11994479 To clarify the cellular and molecular properties of C1qRp it has been demonstrated that C1q does not show enhanced binding to C1qRp-transfected cells, is not a receptor for C1q, and is identical to CD93 with functions relevant to intercellular adhesion.

AA Sequence

MATSMGLLLLLLLLLTQPGAGTGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQ      1 - 70
HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR     71 - 140
CVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSS    141 - 210
SLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGD    211 - 280
GSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQ    281 - 350
DSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGE    351 - 420
DGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKE    421 - 490
GSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQE    491 - 560
PAGGDSSVATQNNDGTDGQKLLLFYILGTVVAILLLLALALGLLVYRKRRAKREEKKEKKPQNAADSYSW    561 - 630
VPERAESRAMENQYSPTPGTDC                                                    631 - 652
//

Text Mined References (62)

PMID Year Title
26387756 2015 CD93 Marks a Non-Quiescent Human Leukemia Stem Cell Population and Is Required for Development of MLL-Rearranged Acute Myeloid Leukemia.
26363010 2015 Elevated expression of the C-type lectin CD93 in the glioblastoma vasculature regulates cytoskeletal rearrangements that enhance vessel function and reduce host survival.
26008729 2015 CD93 gene polymorphism is associated with disseminated colorectal cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25288439 2014 The role of the globular heads of the C1q receptor in HPV-16 E2-induced human cervical squamous carcinoma cell apoptosis via a mitochondria-dependent pathway.
24807719 2014 Antibody-mediated enhancement of parvovirus B19 uptake into endothelial cells mediated by a receptor for complement factor C1q.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
24033555 2013 Unique properties of cluster of differentiation 93 in the umbilical cord blood of neonates.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23651874 2013 The role of globular heads of the C1q receptor in HPV 16 E2-induced human cervical squamous carcinoma cell apoptosis is associated with p38 MAPK/JNK activation.
23272129 2012 The epidermal growth factor-like domain of CD93 is a potent angiogenic factor.
23268996 2012 The globular heads of the C1q receptor regulate apoptosis in human cervical squamous carcinoma cells via a p53-dependent pathway.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23052251 2012 The role of the globular heads of C1q receptor (gC1qR) gene in regulating apoptosis of human cervical squamous cell carcinoma.
22206251 2012 CD93: recent advances and implications in disease.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21768350 2011 Serine protease autotransporters from Shigella flexneri and pathogenic Escherichia coli target a broad range of leukocyte glycoproteins.
21332844 2011 Plasma CD93 concentration is a potential novel biomarker for coronary artery disease.
20512406 2010 Flow cytometric identification of CD93 expression on naive T lymphocytes (CD4(+)CD45RA (+) cells) in human neonatal umbilical cord blood.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19796797 2009 Novel pathogenic mechanism and therapeutic approaches to angioedema associated with C1 inhibitor deficiency.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19372141 2009 Candidate gene approach evaluates association between innate immunity genes and breast cancer risk in Korean women.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19166692 2009 Usefulness of genetic polymorphisms and conventional risk factors to predict coronary heart disease in patients with familial hypercholesterolemia.
18834607 2008 A hantavirus causing hemorrhagic fever with renal syndrome requires gC1qR/p32 for efficient cell binding and infection.
18599554 2008 Replication study of 10 genetic polymorphisms associated with coronary heart disease in a specific high-risk population with familial hypercholesterolemia.
18094537 2007 Decrease in CD93 (C1qRp) expression in a human monocyte-like cell line (U937) treated with various apoptosis-inducing chemical substances.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16381901 2006 The LIFEdb database in 2006.
15819698 2005 Modulated interaction of the ERM protein, moesin, with CD93.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459234 2005 CD93 interacts with the PDZ domain-containing adaptor protein GIPC: implications in the modulation of phagocytosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12891708 2003 Cell surface expression of C1qRP/CD93 is stabilized by O-glycosylation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213329 2002 Zinc induces exposure of hydrophobic sites in the C-terminal domain of gC1q-R/p33.
12140365 2002 C1qRp defines a new human stem cell population with hematopoietic and hepatic potential.
11994479 2002 Human C1qRp is identical with CD93 and the mNI-11 antigen but does not bind C1q.
11781389 2002 Identification of human CD93 as the phagocytic C1q receptor (C1qRp) by expression cloning.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11204562 2001 Factor XII-dependent contact activation on endothelial cells and binding proteins gC1qR and cytokeratin 1.
11086025 2000 Interaction between complement receptor gC1qR and hepatitis C virus core protein inhibits T-lymphocyte proliferation.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10648005 2000 Structural and functional evidence for microglial expression of C1qR(P), the C1q receptor that enhances phagocytosis.
10430665 1999 Cloning of the mouse homolog of the 126-kDa human C1q/MBL/SP-A receptor, C1qR(p).
10092817 1999 C1qRP is a heavily O-glycosylated cell surface protein involved in the regulation of phagocytic activity.
9777410 1998 C1q receptors: regulating specific functions of phagocytic cells.
9476117 1997 The C1q and collectin binding site within C1q receptor (cell surface calreticulin).
9469455 1998 C1qRP, the C1q receptor that enhances phagocytosis, is detected specifically in human cells of myeloid lineage, endothelial cells, and platelets.
9233640 1997 Evidence that the two C1q binding membrane proteins, gC1q-R and cC1q-R, associate to form a complex.
9136074 1997 Interaction between Alzheimer's disease beta A4 precursor protein (APP) and the extracellular matrix: evidence for the participation of heparan sulfate proteoglycans.
9047234 1997 cDNA cloning and primary structure analysis of C1qR(P), the human C1q/MBL/SPA receptor that mediates enhanced phagocytosis in vitro.
8710908 1996 Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular "heads" of C1q (gC1q-R).
8062452 1994 Calreticulin is released from activated neutrophils and binds to C1q and mannan-binding protein.
2212670 1990 Platelet C1q receptor interactions with collagen- and C1q-coated surfaces.
1377218 1992 Short amino acid sequences derived from C1q receptor (C1q-R) show homology with the alpha chains of fibronectin and vitronectin receptors and collagen type IV.