Property Summary

NCBI Gene PubMed Count 170
PubMed Score 768.80
PubTator Score 422.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
glioblastoma 1.400 2.9e-03
malignant mesothelioma -3.800 4.5e-09
esophageal adenocarcinoma -1.800 2.4e-02
psoriasis 1.100 2.8e-04
osteosarcoma 1.805 2.7e-03
posterior fossa group A ependymoma 1.900 3.8e-12
medulloblastoma, large-cell -2.200 8.7e-03
Duchenne muscular dystrophy 1.271 1.7e-06
limb girdle muscular dystrophy 2I 1.026 4.5e-03
autosomal dominant Emery-Dreifuss muscul... 1.183 8.3e-03
Becker muscular dystrophy 1.098 8.1e-03
fascioscapulohumeral muscular dystrophy 1.043 4.3e-04
juvenile dermatomyositis 1.015 3.3e-07
tuberculosis -1.700 4.1e-04
primary pancreatic ductal adenocarcinoma 1.465 3.9e-03
lung cancer -2.700 1.8e-06
pancreatic cancer 1.500 3.5e-03
interstitial cystitis -1.400 1.5e-05
pediatric high grade glioma 1.300 1.4e-03
group 4 medulloblastoma -1.800 2.7e-04
pilocytic astrocytoma 1.600 4.8e-06
invasive ductal carcinoma 1.600 8.8e-03
progressive supranuclear palsy -1.500 2.4e-02
gastric carcinoma 1.700 1.7e-02
ductal carcinoma in situ 1.500 1.6e-03
ovarian cancer 3.900 3.6e-05
Down syndrome 1.800 8.7e-04
dermatomyositis 1.300 9.7e-03

Protein-protein Interaction (2)

Gene RIF (125)

PMID Text
26855131 Collectively, using tetraspanin CD9 in tandem with E-cadherin as a biomarker in renal cell carcinoma will help to not only distinguish between types, but also predict the metastatic potential of RCC.
26573230 Data suggest that CD9 should be further evaluated as a target for glioblastoma treatment.
26378766 CD9-enriched microdomains negatively regulate LPS-induced receptor formation by preventing CD14 from accumulating into lipid rafts. [Review]
26320102 High CD9 is associated with B acute lymphoblastic leukemia.
26275786 Low levels of CD9 coincidental with a novel nonsense mutation in glycoprotein Ibbeta in a patient with Bernard-Soulier syndrome.
26045817 CD9 expression is upregulated and its expression is correlated with tumor stage and lymph node metastasis in esophageal squamous cell carcinoma patients
26003300 The mechanism responsible for this negative regulation exerted by CD9 on LFA-1 adhesion does not involve changes in the affinity state of this integrin but seems to be related to alterations in its state of aggregation.
25955689 Results indicate that CD9 downregulation promoted pancreatic cancer cell proliferation and migration through at least in part, enhancing the cell surface expression of EGFR.
25840601 CD9 plays a role in the dysmegakaryopoiesis that occurs in primary myelofibrosis.
25762645 Data indicate that CD9 is implicated in BCC invasiveness and metastases by cellular mechanisms that involve specific CD9+ plasma membrane protrusions of BCCs.
25760022 These results suggested that the mechanism underlying CD9-induced suppression of cell proliferation may involve the inhibition of phosphorylation of EGFR and the activity of PI3K/Akt and MAPK/Erk signaling pathways
25673160 OY-TES-1 downregulation in liver cancer cells inhibits cell proliferation by upregulating CD and downregulating NANOG.
25551757 The cysteine residues involved in the formation of the disulfide bridges in CD9 EC2 were all essential for inhibiting multinucleated giant cell formation but a conserved glycine residue in the tetraspanin-defining 'CCG' motif was not.
25536312 Although the current findings did not prove any hypothesis, the indispensable role of CD9 in fertilization process was not excluded and the precise role of CD9 remains unexplained. [review]
25265322 switch from alphavbeta5 to alphavbeta6 integrin plays a key role in CD9-regulated cell migration and MMP-9 activation in keratinocytes
25200404 The results demonstrate that hypoxia regulates CD9 expression and CD9-mediated keratinocyte migration via the p38/MAPK pathway.
25184334 alteration in CD9 expression was sufficient to profoundly disrupt cellular actin arrangement and endogenous cell contraction by interfering with RhoA signaling.
25103498 Report shows that breast cancer cells contain a nuclear CD9 pool and that the abrogation of CD9 expression results in multipolar mitoses and polynucleation.
25009540 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
24991932 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
24747564 Introduction of CD9 expression in Raji cells resulted in significantly increased cell proliferation and HDAC activity compared to mock transfected Raji cells.
24723389 CD9 and CD151 support integrin-mediated signaling at the immunological synapse.
24608085 CD9 and CD63 tetraspanins block HIV-1-induced cell-cell fusion at the transition from hemifusion to pore opening.
24608085 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
24553302 High expression of CD9 was statistically associated with older patients
24531716 this study indicated that sialylation involved in the development of MDR of AML cells probably through ST3GAL5 or ST8SIA4 regulating the activity of PI3K/Akt signaling and the expression of P-gp and MRP1.
24466195 Loss of CD9 expression is associated with enhancement of invasive potential of malignant mesothelioma.
24246676 this study points to EGFR as a key mediator between CD9-mediated pro-MMP-9 release and cellular invasion of HT1080 cells.
24201754 This is the first study of the expression and prognostic potential of the tetraspanins in oral dysplasia.
24145510 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
24038577 Heparin-binding epidermal growth factor and CD9 are likely implicated in processes that are highly relevant for MS lesion formation
23840773 The second extracellular loop of CD9 was responsible for the upregulation of MMP-9 production.
23613949 Both CD9/CD81-silenced cells and CD151-silenced cells showed delayed alpha3beta1-dependent cell spreading on laminin-332.
23389628 Data indicate that CD9 acts as scaffold and assembles a ternary JAM-A-CD9-alphavbeta3 integrin complex from which JAM-A is released upon bFGF stimulation.
23291167 these data suggest that CD9 is a novel marker for a human germinal center-B cell subset that is committed to plasma cell lineage.
23225418 CD9 overexpression was confirmed in osteotropic cells. CD9 was significantly overexpressed in bone metastases versus primary tumors and visceral metastatic lesions.
23223239 tetraspanin CD9 modulates molecular organization of integrins in lymphatic endothelial cells, thereby supporting several functions required for lymphangiogenesis
23128478 Low CD9 expression is associated with malignant mesothelioma.
22980332 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
22613496 Low CD9 expression is associated with gallbladder neoplasms
22592495 identifies human male germ cells with capability of long-term survival and cell turnover in the xenogeneic testis environment
22095071 Knockdown of CD9 by siRNA and blockage of CD9 activity by ALB6 in ovarian cancer cells demonstrated that constitutive activation of NF-kappaB is CD9 dependent and that CD9 is involved in anti-apoptosis
21813604 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
21549094 CD9 links to several signaling pathways and epigenetic modification for regulating the cancer stem cell properties of B-ALL.
21521534 decreased levels of CD9 are strongly associated with an increased risk of recurrence.
21428940 CD9-deficiency leads to impaired localization of talin1 to focal adhesions and correlates with increased motility of breast cancer cells.
21365281 CD9 associates with ADAM17 and, through this interaction, negatively regulates the sheddase activity of ADAM17.
21244575 Low CD9 is associated with metastatic gastrointestinal stromal tumors.
21241315 show for the first time that CD9 and CD81 act as molecular partners of trimeric FcvarepsilonRI on human antigen-presenting cell
21161334 Functional and biochemical studies of CD9 in fibrosarcoma cell line.
21063023 CD9 expression was modulated via CXCR4, G-protein, protein kinase C, phospholipase C, extracellular signal-regulated kinase, and Janus kinase 2 signals in cord blood CD34+ hematopoietic stem cells
20940407 Findings implicate CD9 in the cell adhesion-mediated drug resistance mechanisms in small cell lung cancer.
20727121 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
20566742 These findings imply that CD9 is inversely correlated with B lymphoma progression, and CD9 inactivation may play an important role in B lymphoma transformation.
20547009 CD9 expression in gastric cancer appears to be associated with poor prognosis.
20422979 Expression of CD9 increased in glottic carcinoma and adjacent tissues.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20227387 CUGBP1 directly controls CD9 expression.
20118909 These observations provide an example for a posttranscriptional fine-tuning of CD9 gene expression in tumor cells.
19955810 Observational study of gene-disease association. (HuGE Navigator)
19896186 CD9 expression can be used to predict childhood TEL/AML1-positive acute lymphoblastic leukemia.
19894777 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
19802344 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
19777564 Data show that overexpression of CD9 in the metastatic melanoma cell line WM9 decreased anchorage-independent growth, while transient overexpression of CD9 in the radial growth phase cell line SbCl2 resulted in the gain of Matrigel invasion activity.
19692500 CD9 increases GCM1 expression via the cAMP/PKA signaling pathway, resulting in the increase in ERVWE1 expression.
19602278 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
19559406 Levels of CD9 expressed in A431 cells are much higher than those expressed in KB cells and motility of A431 cells is also much higher than that of KB cells.
19458002 CD9, CD81 and CD63 are negative regulators of HIV-1-induced cell-cell fusion.
19458002 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
19426143 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
19330835 Over-expression of CD9 is associated with malignancy of gingival squamous cell carcinoma.
19254692 These results suggest that CD9 is a useful positive-selection marker for the identification of cancer stem cell in B-acute lymphoblastic leukemia cells.
18981120 tetraspanins regulate the activity of ADAM10 toward several substrates
18725936 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
18710926 These data show the high dynamic of interactions in the tetraspanin web and further indicate that the tetraspanin web is distinct from raft microdomains.
18544636 the role of CD9 in the presentation of TGFalpha in epithelial and carcinoma cells, whose physiology is driven by ligand-induced EGFR activation.
18541721 Ectopic expression of CD9 in HT1080 cells actually reduced their metastatic ability. CD9 expression reduced lung retention and platelet aggregation activity of the transfectants.
18508921 DHHC2 affects palmitoylation, stability, and functions of tetraspanins CD9 and CD151
18483358 CD9 expression correlates with disease status and survival of multiple myeloma patients.
18321974 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
18247373 Results demonstrate the physical and functional association of CD9 with epidermal growth factor receptor on MKN-28 cells.
18034776 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
18000614 examined whether CD63-PI4K55 and CD9-PI4K55 complexes were resident in platelet-lipid rafts, or formed distinct microdomains
17997888 The absence or down-regulation of CD9 expression and point mutation may play a considerable role in the pathway of the malignant transformation in the BEAS-2B cells induced by mineral powder.
17989173 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
17845760 CD10 and CD9 expression correlates with the invasiveness and metastatic potential of malignant melanoma.
17668233 CD9 plays roles in cell proliferation and attachment in vitro as well as in in vivo engraftment and that it can be considered as a useful marker to predict the in vivo efficacy of human adipose-derived mesenchymal stem cells.
17644758 Nine potential tetraspanin CD9 partners, including claudin-1, were identified.
17582603 establish for the first time a role for CD9 in the tumorigenic process
17522207 Data show that HIV-1 envelope glycoprotein (Env) and core protein (Gag) colocalize strongly with CD63 and CD81 and less strongly with CD9, and suggest that HIV-1 promotes virus assembly and cell-cell transfer by targeting these plasma membrane proteins.
17407154 transferrin receptor and CD9, CD81, and CD9P-1 are differentially sorted into exosomes after TPA treatment of K562 cells
17406028 CD9 gene inactivation may play an important role in prostate cancer progression.
17393117 Expression of CD9 in transitional cell carcinoma bladder is reported.
17203208 results clearly point to an involvement of CD9 in the attachment, uptake or processing of adeno-associated virus-2 by target cells
17018612 Ectopic CD9 expression suppressed neurite-like process outgrowth & promoted apoptotic death of some SCLC cells. Its absence in SLCL may contribute to postadhesive morphologic differentiation, survival, & MMP-2 production via PI3K/Akt pathway.
17015697 role of CD81 and CD9 on the cell-to-cell fusion process mediated by HIV-1, syncytia formation induced by HIV-1 envelope proteins and viral entry in human T lymphoblasts
17015697 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
16951553 CD9 molecules on endothelial cells participate in the mitogenic effect of platelets; results suggest that the tetraspanin CD9 plays an important role in endothelial regeneration
16940516 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
16900214 CD9 expression by multiple myeloma cells is upregulated in vivo by close interaction of the cells with endothelial cells and CD9 is involved in transendothelial invasion
16735575 Recruitment of Env to tetraspanin-enriched micro domains (TEMs) is required for cell-cell fusion repression by CD9 and CD63
16682943 MRP-1/CD9 regulates the actin cytoskeleton by downregulating of the WAVE2, through the Wnt-independent signal pathway.
16537545 EWI proteins EWI-2 and EWI-F, alpha3beta1 and alpha6beta4 integrins, and protein palmitoylation have contrasting effects on cell surface CD9 organization
16491954 results suggest that the restored expression of CD9 in SCLC cells may reduce the metastatic spread of SCLC cells via the inhibition of cell proliferation and motility
16297202 A role of CD9 in melanocyte motility was shown.
16144798 CD9 is essential for the IL-16-mediated chemotaxis and activation, acting as an IL-16 receptor in HMC-1, a mast cell line that lacks CD4
16128989 results have shown that CD-9 is present in prostate tumour epithelial cells and that it is regulated by androgens in LNCaP-FGC cells
16103120 phenotypic conversion and reversion of bladder cancer cells is controlled by a glycosynapse 3 microdomain through GM3-mediated interaction of alpha3beta1 integrin with CD9
15985154 tetraspanin intra- and intermolecular interactions are mediated by conserved residues in adjacent, but distinct regions of TM1 and TM2
15941914 leukocyte antigen-DR, CD38, and CD9 share a common pathway of tyrosine kinase activation in human monocytes
15591117 endothelial CD9 tetraspanins relocalize to the contact site with transmigrating leukocytes and associate laterally with both intercellular adhesion molecule-1 (ICAM-1) and vascular cell adhesion molecule-1 (VCAM-1)
15476162 The MRP-1/CD9 gene expression was down-regulated in gastric cancer, its expression was probably related to the carcinogenesis and histology types of gastric cancer.
15389525 cell-surface expression of CD9, a beta1 integrin-associated transmembrane protein that is involved in cell adhesion and cell motility events, was enhanced in the ra-a47 anti-sense oligonucleotide-treated cells.
15226408 CD9 activates the p46 Shc isoform in tumor cells and leads to apoptosis
15145525 CD9 does not have a role in progression of human osteosarcoma or predict its prognosis
15047125 CD9 expression was rather intensified in gastric cancer tissue in comparison with normal tissues. CD9 expression was more prominent in advanced gastric cancer.
12579280 downregulation of CD9 antigen is associated with breast tumor progression
12569360 low expression of CD9 may contribute to the highly invasive and metastatic phenotype of small cell lung cancer
12453879 The second extracellular loop sequence (173)LETFTVKSCPDAIKEVFDNK(192) is largely responsible for trasnfected human CD9-mediated CHO cell adhesion to fibronectin and fibronectin pericellular matrix assembly.
12411441 Data show that the expression of the PAINS-13 epitope depends on CD9 association with alpha(6)beta(1) integrin.
12086470 Infertility of CD9-deficient mouse eggs is reversed by human CD9
12036870 C-kit is physically associated with transmembrane 4 superfamily proteins CD9, CD63, and CD81, that may negatively modulate c-kit and thus regulate c-kit receptor sensitivity to SLF in hematopoietic progenitors.
11959120 By site-directed mutagenesis, CD9 was found to be palmitoylated at any of the four internal juxtamembrane regions.
11920609 CD9 protein expression was inversely associated with lymph node metastasis.
11858824 peripheral blood monocytes treated for 5--8 days with GM-CSF (i.e. mature Mphi) acquired the capacity to assemble CD9 with alpha3-beta1 integrin, tyrosine phosphatase SHP-1 and with CD46.

AA Sequence

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALM      1 - 70
MLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQR     71 - 140
ETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFG    141 - 210
MIFSMILCCAIRRNREMV                                                        211 - 228
//

Text Mined References (172)

PMID Year Title
26855131 2016 The utility of tetraspanin CD9 as a biomarker for metastatic clear cell renal cell carcinoma.
26573230 2016 Transmembrane protein CD9 is glioblastoma biomarker, relevant for maintenance of glioblastoma stem cells.
26378766 2015 Preventive Role of Tetraspanin CD9 in Systemic Inflammation of Chronic Obstructive Pulmonary Disease.
26320102 2015 CD9, a key actor in the dissemination of lymphoblastic leukemia, modulating CXCR4-mediated migration via RAC1 signaling.
26275786 2015 Low levels of CD9 coincidental with a novel nonsense mutation in glycoprotein Ib? in a patient with Bernard-Soulier syndrome.
26045817 2015 Overexpression of CD9 correlates with tumor stage and lymph node metastasis in esophageal squamous cell carcinoma.
26003300 2015 Different states of integrin LFA-1 aggregation are controlled through its association with tetraspanin CD9.
25955689 2015 Downregulation of CD9 promotes pancreatic cancer growth and metastasis through upregulation of epidermal growth factor on the cell surface.
25840601 2015 Tetraspanin CD9 participates in dysmegakaryopoiesis and stromal interactions in primary myelofibrosis.
25762645 2015 Tetraspanin CD9 determines invasiveness and tumorigenicity of human breast cancer cells.
25760022 2015 CD9 modulates proliferation of human glioblastoma cells via epidermal growth factor receptor signaling.
25673160 2015 OY-TES-1 may regulate the malignant behavior of liver cancer via NANOG, CD9, CCND2 and CDCA3: a bioinformatic analysis combine with RNAi and oligonucleotide microarray.
25551757 2014 Distinct regions of the large extracellular domain of tetraspanin CD9 are involved in the control of human multinucleated giant cell formation.
25536312 2015 Role of tetraspanin CD9 molecule in fertilization of mammals.
25265322 2014 Switch from ?v?5 to ?v?6 integrin is required for CD9-regulated keratinocyte migration and MMP-9 activation.
25200404 2014 Hypoxia regulates CD9-mediated keratinocyte migration via the P38/MAPK pathway.
25184334 2014 Tetraspanin CD9 regulates cell contraction and actin arrangement via RhoA in human vascular smooth muscle cells.
25103498 2014 The nuclear pool of tetraspanin CD9 contributes to mitotic processes in human breast carcinoma.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24747564 2014 Tetraspanin CD9 modulates human lymphoma cellular proliferation via histone deacetylase activity.
24723389 2014 Tetraspanins CD9 and CD151 at the immune synapse support T-cell integrin signaling.
24608085 2014 Evidence showing that tetraspanins inhibit HIV-1-induced cell-cell fusion at a post-hemifusion stage.
24553302 2014 Expression of CD9 and CD82 in clear cell renal cell carcinoma and its clinical significance.
24531716 2015 Modification of sialylation is associated with multidrug resistance in human acute myeloid leukemia.
24466195 2014 CD9 negatively regulates CD26 expression and inhibits CD26-mediated enhancement of invasive potential of malignant mesothelioma cells.
24246676 2013 Pro-MMP-9 upregulation in HT1080 cells expressing CD9 is regulated by epidermal growth factor receptor.
24201754 2013 Tetraspanins CD9 and CD151, epidermal growth factor receptor and cyclooxygenase-2 expression predict malignant progression in oral epithelial dysplasia.
24038577 2013 Roles for HB-EGF and CD9 in multiple sclerosis.
23840773 2013 Tetraspanin CD9 promotes the invasive phenotype of human fibrosarcoma cells via upregulation of matrix metalloproteinase-9.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
23613949 2013 The CD9/CD81 tetraspanin complex and tetraspanin CD151 regulate ?3?1 integrin-dependent tumor cell behaviors by overlapping but distinct mechanisms.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23389628 2013 Tetraspanin CD9 links junctional adhesion molecule-A to ?v?3 integrin to mediate basic fibroblast growth factor-specific angiogenic signaling.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23291167 2013 CD9 is a novel marker for plasma cell precursors in human germinal centers.
23289620 2013 Tetraspanin protein CD9 interacts with metalloprotease CD10 and enhances its release via exosomes.
23225418 2012 Overexpression of CD9 in human breast cancer cells promotes the development of bone metastases.
23223239 2013 Deletion of tetraspanin CD9 diminishes lymphangiogenesis in vivo and in vitro.
23128478 2013 CD9 expression as a favorable prognostic marker for patients with malignant mesothelioma.
22613496 2012 Expression levels of HMGA2 and CD9 and its clinicopathological significances in the benign and malignant lesions of the gallbladder.
22592495 2012 CD9 is expressed on human male germ cells that have a long-term repopulation potential after transplantation into mouse testes.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22095071 2012 Upregulation of CD9 in ovarian cancer is related to the induction of TNF-? gene expression and constitutive NF-?B activation.
21549094 2011 Regulation of cancer stem cell properties by CD9 in human B-acute lymphoblastic leukemia.
21521534 2011 Down-regulation of TM4SF is associated with the metastatic potential of gastric carcinoma TM4SF members in gastric carcinoma.
21428940 2011 Tetraspanin CD9 in cell migration.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21365281 2011 The sheddase activity of ADAM17/TACE is regulated by the tetraspanin CD9.
21269460 2011 Initial characterization of the human central proteome.
21244575 2011 Microarray analysis identifies versican and CD9 as potent prognostic markers in gastric gastrointestinal stromal tumors.
21241315 2011 Tetraspanins CD9 and CD81 are molecular partners of trimeric Fc?RI on human antigen-presenting cells.
21161334 2011 Functional and biochemical studies of CD9 in fibrosarcoma cell line.
21063023 2011 The tetraspanin CD9 regulates migration, adhesion, and homing of human cord blood CD34+ hematopoietic stem and progenitor cells.
21036922 2011 Discovery of non-ETS gene fusions in human prostate cancer using next-generation RNA sequencing.
20940407 2010 Cell surface tetraspanin CD9 mediates chemoresistance in small cell lung cancer.
20937409 2011 Activation-induced internalization differs for the tetraspanins CD9 and Tspan8: Impact on tumor cell motility.
20862371 2010 CD9 Expression by Human Granulosa Cells and Platelets as a Predictor of Fertilization Success during IVF.
20727121 2010 HIV-1 assembly differentially alters dynamics and partitioning of tetraspanins and raft components.
20574531 2010 The tetraspanins CD9 and CD81 regulate CD9P1-induced effects on cell migration.
20566742 2010 Down-regulation of CD9 expression and its correlation to tumor progression in B lymphomas.
20547009 2010 Prognostic significance of CD9 expression in locally advanced gastric cancer treated with surgery and adjuvant chemoradiotherapy.
20422979 2010 [Clinical significance of SKP2 and MRP-1/CD9 expression in glottic carcinoma and adjacent tissues].
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20227387 2010 Chromosome wide analysis of CUGBP1 binding sites identifies the tetraspanin CD9 mRNA as a target for CUGBP1-mediated down-regulation.
20118909 2010 Expression of the tetraspanins CD9, CD37, CD63, and CD151 in Merkel cell carcinoma: strong evidence for a posttranscriptional fine-tuning of CD9 gene expression.
19955810 2010 CD9 gene variations are not associated with female infertility in humans.
19896186 2010 CD9 expression can be used to predict childhood TEL/AML1-positive acute lymphoblastic leukemia: proposal for an accelerated diagnostic flowchart.
19777564 2010 Expression and function of CD9 in melanoma cells.
19692500 2009 CD9 regulates transcription factor GCM1 and ERVWE1 expression through the cAMP/protein kinase A signaling pathway.
19640571 2010 Palmitoylation supports the association of tetraspanin CD63 with CD9 and integrin alphaIIbbeta3 in activated platelets.
19559406 2009 Control of cell motility by interaction of gangliosides, tetraspanins, and epidermal growth factor receptor in A431 versus KB epidermoid tumor cells.
19458002 2009 Formation of syncytia is repressed by tetraspanins in human immunodeficiency virus type 1-producing cells.
19330835 2009 Tetraspanin gene expression levels as potential biomarkers for malignancy of gingival squamous cell carcinoma.
19254692 2009 CD9 correlates with cancer stem cell potentials in human B-acute lymphoblastic leukemia cells.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18981120 2008 Tetraspanins regulate ADAM10-mediated cleavage of TNF-alpha and epidermal growth factor.
18710926 2008 Single-molecule analysis of CD9 dynamics and partitioning reveals multiple modes of interaction in the tetraspanin web.
18544636 2008 Association of tetraspanin CD9 with transmembrane TGF{alpha} confers alterations in cell-surface presentation of TGF{alpha} and cytoskeletal organization.
18541721 2008 Tetraspanin family member CD9 inhibits Aggrus/podoplanin-induced platelet aggregation and suppresses pulmonary metastasis.
18508921 2008 DHHC2 affects palmitoylation, stability, and functions of tetraspanins CD9 and CD151.
18483358 2008 Epigenetic silencing of the tetraspanin CD9 during disease progression in multiple myeloma cells and correlation with survival.
18247373 2008 The tetraspanin CD9 modulates epidermal growth factor receptor signaling in cancer cells.
18000614 2007 Platelet tetraspanin complexes and their association with lipid rafts.
17997888 2007 [Expression and gene mutation of cluster of differentiation 9 in lung cancer cells induced by mineral powder in Gejiu].
17845760 2007 [Expression of neutral endopeptidase and motility-related protein-1 in cutaneous malignant melanoma].
17668233 2007 Role of CD9 in proliferation and proangiogenic action of human adipose-derived mesenchymal stem cells.
17644758 2007 A novel cysteine cross-linking method reveals a direct association between claudin-1 and tetraspanin CD9.
17582603 2007 The tetraspanin CD9 inhibits the proliferation and tumorigenicity of human colon carcinoma cells.
17522207 2007 Human immunodeficiency virus type 1 assembly, budding, and cell-cell spread in T cells take place in tetraspanin-enriched plasma membrane domains.
17407154 2007 The transferrin receptor and the tetraspanin web molecules CD9, CD81, and CD9P-1 are differentially sorted into exosomes after TPA treatment of K562 cells.
17406028 2007 Down-regulation of CD9 expression during prostate carcinoma progression is associated with CD9 mRNA modifications.
17393117 2007 Expression of KAI1/CD82 and MRP-1/CD9 in transitional cell carcinoma of bladder.
17203208 2007 CD9 promotes adeno-associated virus type 2 infection of mammary carcinoma cells with low cell surface expression of heparan sulphate proteoglycans.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
17018612 2006 Absence of CD9 enhances adhesion-dependent morphologic differentiation, survival, and matrix metalloproteinase-2 production in small cell lung cancer cells.
17015697 2006 Tetraspanins CD9 and CD81 modulate HIV-1-induced membrane fusion.
16951553 2006 Monoclonal antibody to CD9 inhibits platelet-induced human endothelial cell proliferation.
16900214 2006 Endothelial cell-driven regulation of CD9 or motility-related protein-1 expression in multiple myeloma cells within the murine 5T33MM model and myeloma patients.
16682943 2006 MRP-1/CD9 gene transduction regulates the actin cytoskeleton through the downregulation of WAVE2.
16537545 2006 Contrasting effects of EWI proteins, integrins, and protein palmitoylation on cell surface CD9 organization.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16491954 2005 CD9 overexpression suppressed the liver metastasis and malignant ascites via inhibition of proliferation and motility of small-cell lung cancer cells in NK cell-depleted SCID mice.
16341674 2005 Transcriptome analysis of human gastric cancer.
16297202 2005 Role of tetraspanins CD9 and CD151 in primary melanocyte motility.
16144798 2006 Human and mouse mast cells use the tetraspanin CD9 as an alternate interleukin-16 receptor.
16128989 2005 Androgens induce CD-9 in human prostate tissue.
16103120 2005 A specific microdomain ("glycosynapse 3") controls phenotypic conversion and reversion of bladder cancer cells through GM3-mediated interaction of alpha3beta1 integrin with CD9.
15985154 2005 Structural organization and interactions of transmembrane domains in tetraspanin proteins.
15941914 2005 MHC class II/CD38/CD9: a lipid-raft-dependent signaling complex in human monocytes.
15908444 2005 Exosomal-like vesicles are present in human blood plasma.
15591117 2005 Endothelial tetraspanin microdomains regulate leukocyte firm adhesion during extravasation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476162 2004 [Differential expression of motility-related protein-1/CD9 gene in gastric cancers and premalignant lesions].
15389525 2005 Downregulation of rheumatoid arthritis-related antigen RA-A47 (HSP47/colligin-2) in chondrocytic cell lines induces apoptosis and cell-surface expression of RA-A47 in association with CD9.
15326289 2004 Identification and proteomic profiling of exosomes in human urine.
15226408 2004 CD9-mediated activation of the p46 Shc isoform leads to apoptosis in cancer cells.
15196249 2004 The tetraspanin CD9 is preferentially expressed on the human CD4(+)CD45RA+ naive T cell population and is involved in T cell activation.
15145525 2004 CD9 expression is not a prognostic factor in human osteosarcoma.
15047125 2004 CD9 expression in gastric cancer and its significance.
14575715 2003 Structural requirements for the inhibitory action of the CD9 large extracellular domain in sperm/oocyte binding and fusion.
14556650 2004 Evidence for specific tetraspanin homodimers: inhibition of palmitoylation makes cysteine residues available for cross-linking.
12579280 Expression of tetraspanin adaptor proteins below defined threshold values is associated with in vitro invasiveness of mammary carcinoma cells.
12569360 2003 Expression of tetraspanins in human lung cancer cells: frequent downregulation of CD9 and its contribution to cell motility in small cell lung cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453879 2002 Identification of CD9 extracellular domains important in regulation of CHO cell adhesion to fibronectin and fibronectin pericellular matrix assembly.
12411441 2003 A functionally relevant conformational epitope on the CD9 tetraspanin depends on the association with activated beta1 integrin.
12175627 2002 Expression of transmembrane 4 superfamily (TM4SF) proteins and their role in hepatic stellate cell motility and wound healing migration.
12086470 2002 Infertility of CD9-deficient mouse eggs is reversed by mouse CD9, human CD9, or mouse CD81; polyadenylated mRNA injection developed for molecular analysis of sperm-egg fusion.
12036870 2002 C-kit associated with the transmembrane 4 superfamily proteins constitutes a functionally distinct subunit in human hematopoietic progenitors.
11959120 2002 Differential stability of tetraspanin/tetraspanin interactions: role of palmitoylation.
11920609 2002 Significance of the association between heparin-binding epidermal growth factor-like growth factor and CD9 in human gastric cancer.
11858824 2002 Molecular assembly of CD46 with CD9, alpha3-beta1 integrin and protein tyrosine phosphatase SHP-1 in human macrophages through differentiation by GM-CSF.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
11735113 2001 CD9 amino acids critical for upregulation of diphtheria toxin binding.
11504738 2001 EWI-2 is a major CD9 and CD81 partner and member of a novel Ig protein subfamily.
11325968 2001 Transmembrane-4 superfamily proteins associate with activated protein kinase C (PKC) and link PKC to specific beta(1) integrins.
11278880 2001 The major CD9 and CD81 molecular partner. Identification and characterization of the complexes.
11238109 2001 CD36 associates with CD9 and integrins on human blood platelets.
11204565 2001 CD63 associates with the alphaIIb beta3 integrin-CD9 complex on the surface of activated platelets.
11087758 2001 FPRP, a major, highly stoichiometric, highly specific CD81- and CD9-associated protein.
10711425 2000 The tetraspanin CD9 associates with the integrin alpha6beta4 in cultured human epidermal keratinocytes and is involved in cell motility.
10694273 2000 CD9 is expressed on human endometrial epithelial cells in association with integrins alpha(6), alpha(3) and beta(1).
10518536 1999 Role of the integrin-associated protein CD9 in binding between sperm ADAM 2 and the egg integrin alpha6beta1: implications for murine fertilization.
10515286 1999 Studies on the dual effects on platelets of a monoclonal antibody to CD9, and on the properties of platelet CD9.
10459022 1999 Role of transmembrane 4 superfamily (TM4SF) proteins CD9 and CD81 in muscle cell fusion and myotube maintenance.
10429193 1999 A CD9, alphaIIbbeta3, integrin-associated protein, and GPIb/V/IX complex on the surface of human platelets is influenced by alphaIIbbeta3 conformational states.
10229664 1999 Selective tetraspan-integrin complexes (CD81/alpha4beta1, CD151/alpha3beta1, CD151/alpha6beta1) under conditions disrupting tetraspan interactions.
10227388 1999 Cell surface colligin/Hsp47 associates with tetraspanin protein CD9 in epidermoid carcinoma cell lines.
10065872 1999 CD9 is expressed in extravillous trophoblasts in association with integrin alpha3 and integrin alpha5.
9812906 1998 Tetraspanin CD9 is associated with very late-acting integrins in human vascular smooth muscle cells and modulates collagen matrix reorganization.
9804823 1998 CD19 is linked to the integrin-associated tetraspans CD9, CD81, and CD82.
9360996 1997 NAG-2, a novel transmembrane-4 superfamily (TM4SF) protein that complexes with integrins and other TM4SF proteins.
9295027 1997 CD9, but not other tetraspans, associates with the beta1 integrin precursor.
9133457 1997 Immunohistochemically detected expression of motility-related protein-1 (MRP-1/CD9) in lung adenocarcinoma and its relation to prognosis.
9111230 1997 Localization of the transmembrane 4 superfamily (TM4SF) member PETA-3 (CD151) in normal human tissues: comparison with CD9, CD63, and alpha5beta1 integrin.
8630057 1996 CD63 associates with transmembrane 4 superfamily members, CD9 and CD81, and with beta 1 integrins in human melanoma.
8521390 1995 Reduced motility related protein-1 (MRP-1/CD9) gene expression as a factor of poor prognosis in non-small cell lung cancer.
8486348 1993 Organization of the human CD9 gene.
8478605 1993 Suppression of cell motility and metastasis by transfection with human motility-related protein (MRP-1/CD9) DNA.
7511626 1994 CD9-regulated adhesion. Anti-CD9 monoclonal antibody induce pre-B cell adhesion to bone marrow fibroblasts through de novo recognition of fibronectin.
6792721 1981 A human cell-surface antigen defined by a monoclonal antibody and controlled by a gene on chromosome 12.
6198179 1983 Chromosome assignment of monoclonal antibody-defined determinants on human leukemic cells.
2358073 1990 Purification and partial characterization of CD9 antigen of human platelets.
2037603 1991 cDNA cloning and expression of platelet p24/CD9. Evidence for a new family of multiple membrane-spanning proteins.
1997380 1991 Assignment of the human CD9 gene to chromosome 12 (region P13) by use of human specific DNA probes.
1939101 1991 An antibody that inhibits the binding of diphtheria toxin to cells revealed the association of a 27-kDa membrane protein with the diphtheria toxin receptor.
1879540 1991 Novel structurally distinct family of leucocyte surface glycoproteins including CD9, CD37, CD53 and CD63.
1840589 1991 Molecular cloning of the CD9 antigen. A new family of cell surface proteins.
1720807 1991 Identification of the motility-related protein (MRP-1), recognized by monoclonal antibody M31-15, which inhibits cell motility.
1377690 1992 The human complement regulatory protein CD59 binds to the alpha-chain of C8 and to the "b"domain of C9.