Property Summary

NCBI Gene PubMed Count 174
PubMed Score 775.03
PubTator Score 422.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cancer 2499 4.826 2.4
Hemangioma of spleen 2 3.308 1.7
Diphtheria 40 3.117 1.6

Expression

  Differential Expression (28)

Disease log2 FC p
glioblastoma 1.200 1.4e-04
Astrocytoma, Pilocytic 1.600 5.0e-06
autosomal dominant Emery-Dreifuss muscul... 1.183 8.3e-03
Becker muscular dystrophy 1.098 8.1e-03
dermatomyositis 1.300 9.7e-03
Down syndrome 1.800 8.7e-04
Duchenne muscular dystrophy 1.271 1.7e-06
ductal carcinoma in situ 1.500 1.6e-03
ependymoma 1.700 1.7e-11
esophageal adenocarcinoma -1.800 2.4e-02
fascioscapulohumeral muscular dystrophy 1.043 4.3e-04
gastric carcinoma 1.700 1.7e-02
group 4 medulloblastoma -1.800 2.7e-04
interstitial cystitis -1.200 7.8e-04
invasive ductal carcinoma 1.065 2.0e-03
juvenile dermatomyositis 1.015 3.3e-07
limb girdle muscular dystrophy 2I 1.026 4.5e-03
lung cancer -2.700 1.8e-06
malignant mesothelioma -3.800 4.5e-09
medulloblastoma, large-cell -2.200 8.7e-03
osteosarcoma 1.805 2.7e-03
ovarian cancer 3.900 3.6e-05
pancreatic cancer 1.400 6.4e-06
pediatric high grade glioma 1.300 1.4e-03
primary pancreatic ductal adenocarcinoma 1.465 3.9e-03
progressive supranuclear palsy -1.500 2.4e-02
psoriasis 1.100 2.8e-04
tuberculosis -1.700 4.1e-04

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (129)

AA Sequence

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALM      1 - 70
MLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQR     71 - 140
ETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFG    141 - 210
MIFSMILCCAIRRNREMV                                                        211 - 228
//

Text Mined References (176)

PMID Year Title