Property Summary

NCBI Gene PubMed Count 5
PubMed Score 174.36
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 1.0e-11
Disease Target Count Z-score Confidence
Central nervous system disease 10 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.5 1.8
Laryngotracheitis 10 3.027 1.5

 GO Process (1)

AA Sequence

MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMCIYWLRQRQAPSSDSHHEFL      1 - 70
TLWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVVDFLP     71 - 140
TTAQPTKKSTLKKRVCRLPRPETQKGPLCSPVTLGLLVAGVLVLLVSLGVAMHLCCRRRRARLRFMKQLY    141 - 210
K//

Text Mined References (6)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
8575821 1996 Chromosomal mapping of the second human CD8B gene locus.
8436166 1993 Transcriptional diversity at the duplicated human CD8 beta loci.
8346216 1993 Duplication of the CD8 beta-chain gene as a marker of the man-gorilla-chimpanzee clade.
3860845 1985 Sequence and evolution of the human T-cell antigen receptor beta-chain genes.
1541829 1992 Recent duplication of the two human CD8 beta-chain genes.