Property Summary

NCBI Gene PubMed Count 30
PubMed Score 174.36
PubTator Score 114.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Juvenile arthritis 124
Disease Target Count P-value
osteosarcoma 7933 3.7e-08
Disease Target Count Z-score Confidence
Central nervous system disease 10 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.5 1.8
Laryngotracheitis 10 3.027 1.5
Disease Target Count
progressive supranuclear palsy 674

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.878 3.7e-08

Gene RIF (18)

PMID Text
24495362 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
24297179 CREMalpha orchestrates epigenetic remodeling of the CD8A,B through the recruitment of DNA methyltransferase (DNMT) 3a and histone methyltransferase G9a.
24047902 transcription factor cAMP-responsive element modulator alpha (CREMalpha), which is expressed at increased levels in T cells from systemic lupus erythematosus patients, contributes to transcriptional silencing of CD8A and CD8B.
22844345 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
22013062 Nef-mediated down-modulation of CD8alphabeta is a fundamental property of primate lentiviruses.
22013062 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
21954283 [review] Coreceptor CD8alphabeta contributes to the antigen-recognition process by binding to a largely invariant region of the MHCI molecule and by promoting intracellular signaling.
21936714 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
21922073 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
21543478 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19768696 Data show that CD8+LAP+ cells produce IFN-gamma, and these cells suppress EAE that is dependent on both TGF-beta and IFN-gamma.
19149577 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
18490743 study demonstrated differential mRNA expression patterns of CD8beta splice variants in thymocytes and in resting, memory, and activated primary CD8(+) T cells
18473783 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
16103193 HIV-1 Nef downregulates surface expression of the beta-chain of the CD8 receptor by accelerated endocytosis; amino acid positions 57 to 58 and 174 to 175 in Nef are involved in the down modulation
12702212 RT-PCR, and related methodologies are not useful substitutes for assessment of CD4 and CD8 cell numbers in HIV-infected persons.
11937547 A clustering of DNase hypersensitivity sites and matrix attachment regions capable of binding SATB1 and GATA-3, colocalized at the 3' end of the CD8B gene, suggests that this region is an epigenetic regulator of CD8 expression.

AA Sequence

MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFL      1 - 70
ALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPT     71 - 140
TAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK    141 - 210
//

Text Mined References (32)

PMID Year Title
24297179 2014 cAMP responsive element modulator (CREM) ? mediates chromatin remodeling of CD8 during the generation of CD3+ CD4- CD8- T cells.
24047902 2013 cAMP-responsive element modulator ? (CREM?) trans-represses the transmembrane glycoprotein CD8 and contributes to the generation of CD3+CD4-CD8- T cells in health and disease.
22013062 2012 Down-modulation of CD8?? is a fundamental activity of primate lentiviral Nef proteins.
21954283 2011 The multiple roles of the CD8 coreceptor in T cell biology: opportunities for the selective modulation of self-reactive cytotoxic T cells.
21685912 2011 Identification of common variants influencing risk of the tauopathy progressive supranuclear palsy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19768696 2009 Novel CD8+ Treg suppress EAE by TGF-beta- and IFN-gamma-dependent mechanisms.
18490743 2008 Differential expression of the human CD8beta splice variants and regulation of the M-2 isoform by ubiquitination.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16103193 2005 Human immunodeficiency virus Nef induces rapid internalization of the T-cell coreceptor CD8alphabeta.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12702212 2003 Quantitative competitive reverse transcription polymerase chain reaction is not a useful method for quantification of CD4 and CD8 cell status during HIV infection.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459555 2003 Sialic acid capping of CD8beta core 1-O-glycans controls thymocyte-major histocompatibility complex class I interaction.
12215456 2003 CD3 delta establishes a functional link between the T cell receptor and CD8.
11937547 2002 Identification of a candidate regulatory region in the human CD8 gene complex by colocalization of DNase I hypersensitive sites and matrix attachment regions which bind SATB1 and GATA-3.
11131152 2000 Calyculin A inhibits expression of CD8alpha but not CD4 in human peripheral blood T cells.
10809759 2000 Classical and nonclassical class I major histocompatibility complex molecules exhibit subtle conformational differences that affect binding to CD8alphaalpha.
10623829 2000 Human CD8 beta, but not mouse CD8 beta, can be expressed in the absence of CD8 alpha as a beta beta homodimer.
9830036 1998 Zinc is essential for binding of p56(lck) to CD4 and CD8alpha.
9550407 1997 Comparison of the roles of CD8 alpha alpha and CD8 alpha beta in interaction with MHC class I.
8436166 1993 Transcriptional diversity at the duplicated human CD8 beta loci.
3860845 1985 Sequence and evolution of the human T-cell antigen receptor beta-chain genes.
3264320 1988 A second chain of human CD8 is expressed on peripheral blood lymphocytes.
3145196 1988 The human Lyt-3 molecule requires CD8 for cell surface expression.
3145195 1988 A second subunit of CD8 is expressed in human T cells.
3114136 1987 A human homolog of the mouse CD8 molecule, Lyt-3: genomic sequence and expression.
2536941 1989 A secreted form of the human lymphocyte cell surface molecule CD8 arises from alternative splicing.
2493728 1989 Molecular biology and function of CD4 and CD8.
2111591 1990 Differential expression and regulation of the human CD8 alpha and CD8 beta chains.
1541829 1992 Recent duplication of the two human CD8 beta-chain genes.