Property Summary

NCBI Gene PubMed Count 162
PubMed Score 437.23
PubTator Score 448.48

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis 1.020 2.9e-02
Astrocytoma, Pilocytic 1.200 1.9e-04
diabetes mellitus -1.200 3.8e-02
lung carcinoma -2.200 8.5e-31
malignant mesothelioma -3.600 8.9e-09
medulloblastoma, large-cell -1.200 7.9e-04
oligodendroglioma 1.100 3.7e-03
osteosarcoma -1.222 1.1e-03
ovarian cancer 1.100 2.8e-05
psoriasis 2.200 1.8e-05
tuberculosis -1.500 4.5e-09

Gene RIF (151)

AA Sequence

MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMG      1 - 70
FLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAW     71 - 140
DYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWP    141 - 210
VYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY                 211 - 267
//

Text Mined References (166)

PMID Year Title