Property Summary

NCBI Gene PubMed Count 184
PubMed Score 534.75
PubTator Score 407.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma 1.300 4.1e-02
oligodendroglioma 1.100 2.0e-02
astrocytoma 2.300 7.7e-03
glioblastoma 1.300 4.9e-02
Duchenne muscular dystrophy 1.367 1.0e-09
autosomal dominant Emery-Dreifuss muscul... 1.383 1.5e-03
juvenile dermatomyositis 1.396 9.1e-13
intraductal papillary-mucinous adenoma (... -1.400 2.9e-02
intraductal papillary-mucinous carcinoma... -2.400 1.9e-02
intraductal papillary-mucinous neoplasm ... -2.400 6.5e-03
lung adenocarcinoma -1.100 1.0e-07
lung carcinoma -1.300 1.6e-24
ulcerative colitis 1.200 2.4e-04
ovarian cancer 1.600 5.6e-04

Gene RIF (179)

PMID Text
26926492 CD81 expression was lower in systemic sclerosis patients compared to controls independent of disease duration.
26498453 Results suggest that the CD81 antigen (CD81) expressed by B cells has differential effects on B cell proliferation or apoptosis according to Epstein-Barr virus (EBV) infection and the expression level of CD81.
26195630 LDLR was not required for the degradation of CD81 by PCSK9, but its presence strengthened the PCSK9 effect.
26116703 Data suggest that the intramolecular 188-196 bond restricts the intrinsic conformational dynamics of D-helix of cluster of differentiation 81 (CD81)-large extracellular loop (LEL), which is essential for hepatitis C virus entry.
26111452 We demonstrate that this motif plays a role in the maturation and recycling of CD19 but in a CD81-independent manner.
25940347 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
25934191 findings suggest that homozygous CD81 rs708564 TT may be a genetic modifier for avoiding HCV infection whether as a sole single nucleotide polymorphism or combined with the CLDN1 rs893051 GG genotype
25919665 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
25760631 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
25759385 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
25757571 IFI6 inhibits HCV entry by impairing EGFR mediated CD81/CLDN1 interactions. This may be relevant to other virus entry processes employing EGFR.
25739915 We propose that CD81 enables the maturation of CD19 and its trafficking to the membrane by regulating the exit of CD19 from the ER to the pre-Golgi compartment
25701820 These data revealed the crucial role played by His490 and His621 in hepatitis C virus infection, particularly during CD81 binding in cell entry.
25656410 These observations confirm the role of CD81 in liver-stage malaria and question that of scavenger receptor class B member 1.
25635054 Hsp70/40 stimulated the association of Hsp104 with aggregates and increased the duration of this association
25568205 Vpu-mediated downregulation of CD81 from the surfaces of infected T cells contributed to preserving the infectiousness of viral particles.
25568205 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
25339761 The data suggest an important role played by the W(437)LAGLF(442) helix of the hepatitis C virus E2 protein in the hydrophobic interaction with the D-helix of CD81.
25275127 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
25130443 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
25009540 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
24990994 Amino acids Y507, V514, and V515 of hepatitis C virus E2 contribute to interaction with HCV receptor CD81.
24965233 CLEC4M and CD81 both are still crucial for hepatitis C virus entry into hepatocytes.
24760896 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
24733393 These results strongly suggest that CD81 stimulates melanoma cell motility by inducing MT1-MMP expression through the Akt-dependent Sp1 activation signaling pathway, leading to increased melanoma invasion and metastasis.
24667602 Radiation increases the cellular uptake of exosomes through CD29/CD81 complex formation.
24662676 Authors show enhanced hepatoma migration and invasion following expression of CD81 and a reduction in invasive potential upon CD81 silencing.
24587404 Data indicate that HIV-1 colocalizes with CD81 antigen-lined vesicle compartments in astrocytes.
24549717 We have developed infectious pseudo particles of local 3a-isolate and concluded that a number of liver-specific surface proteins function along with CD81 and SRBI receptor regarding HCV infectivity
24307588 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
24211330 study reported on seven CD81 SNP's present in human populations that all facilitate HCV entry in vitro
24130495 results demonstrate important roles of CD81 in both entry and budding stages of the influenza infection cycle.
24122777 The large extracellular loop (LEL) of CD81 is a molecule that is highly conserved and it was hypothesised that variation in the CD81 LEL sequence may modify susceptibility to HCV infection; no differences in nucleotide sequence influencing susceptibility to, or outcome of hepatitis C virus infection or evidence of methylation of the gene were found.
23858057 CD81 interacts with ICAM-1 and CD3 during conjugation between T cells and antigen-presenting cells
23762099 Two SNPs in the CD81 gene, that encodes the molecule involved in the signal modulation of B lymphocytes, show a strong association with alloimmunization in sickle cell disease.
23704882 A specific association between alpha4beta1 and CD81, CD82 and CD151 was demonstrated and antibodies to CD81 and CD82 augmented adhesion of proerythroblasts to Vascular Cell Adhesion Molecule-1.
23613949 Both CD9/CD81-silenced cells and CD151-silenced cells showed delayed alpha3beta1-dependent cell spreading on laminin-332.
23498955 HRas signal transduction promotes hepatitis C virus cell entry by triggering the host CD81-CLDN1 complex formation.
23351194 Authors demonstrated that EWI-2wint promotes CD81 clustering and confinement in CD81-enriched areas.
23349980 These findings together indicate that the HCV RNA replication status plays a crucial determinant in HCV growth by modulating the expression and intracellular localization of CD81.
23311681 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
23264468 Interaction of Rac1 with the C-terminal cytoplasmic domain of CD81 is a novel regulatory mechanism of the GTPase activity turnover.
23264205 Data indicate frequent down-regulation of CD81 expression in gastric cancer cell lines and primary tumor tissues.
23226274 CD81 interacts with the T cell receptor to suppress signaling.
23126643 In summary, these data highlight the dynamic nature of CD81 and demonstrate a role for CD81 lateral diffusion to regulate hepatitis C virus infection in a polarization-dependent manner.
22980332 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
22897233 Fluorescent Resonance Energy Transfer studies confirm a role for these CD81 residues in claudin-1 association and Hepatitis C virus infection.
22855500 data demonstrate that EGFR internalization is critical for hepatitis C virus entry and identify a hitherto-unknown association between CD81 and EGFR
22830021 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
22808325 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
22740401 A novel membrane binding interface was revealed adjacent to the exposed HCV interaction site in the extracellular loop of CD81.
22677126 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
22560863 These results suggest that palmitoylation of CD81 should facilitate hepatitis C virus entry, at least in part, by regulating the association of CD81 with tetraspanin-enriched microdomains.
22355327 Soluble serum CD81 is elevated in patients with chronic hepatitis C and correlates with alanine aminotransferase serum activity.
22333880 our results show that CD81 may have a relevant role in MM pathogenesis and represent a novel adverse prognostic marker in myeloma.
22074322 Heptatitis c virus (HCV) specific E2 and host CD81 antibodies reduce HCV pseudoparticle entry.
21813604 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
21737455 Hepatitis C virus is primed by CD81 protein for low pH-dependent fusion
21705339 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
21677313 CD81 is required for the formation of actin membrane protrusions via RAC1 activation in adhesion-dependent immune cell migration.
21551950 Expression of human factors CD81, claudin-1, scavenger receptor, and occludin in mouse hepatocytes does not confer susceptibility to hepatitis B virus entry into the liver.
21526201 E2-CD81 engagement may contribute to Hepatitis C virus-associated B cell lymphoproliferative disorders and insufficient neutralizing antibody production.
21428935 Structural characterization of CD81-Claudin-1 hepatitis C virus receptor complexes.
21428934 Hepatitis C virus entry and the tetraspanin CD81.
21343309 analysis of interacting regions of CD81 and two of its partners, EWI-2 and EWI-2wint, and their effect on hepatitis C virus infection
21241315 show for the first time that CD9 and CD81 act as molecular partners of trimeric FcvarepsilonRI on human antigen-presenting cell
21151997 Membrane-Associated RING-CH proteins MARCH VIII and MARCH IV associate with Bap31 and target CD81 and CD44 to lysosomes
21060818 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20727121 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
20588308 Observational study of gene-disease association. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20375010 Essential role for Claudin-CD81 complexes in hepaatitis C virus infection and their localization at the basolateral surface of polarized hepatoma cells.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20237408 CD81 gene defect in humans disrupts CD19 complex formation and leads to antibody deficiency.
20089661 CD81 may control viral replication by directing viral RNA template function to RNA replication.
20012524 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
20004001 The detection of CD81 and its differential expression in lymphoma subtypes, particularly diffuse large B-cell lymphoma, warrant further study to assess CD81 expression and its role in the risk stratification of patients with diffuse large B-cell lymphoma.
19912576 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
19901060 Depletion of CD9, CD63, and CD81 levels by small interfering RNA demonstrated that CD81 is required for bacterial internalization, identifying for the first time a role for a member of the tetraspanin family in the entry of Listeria into target cells.
19894777 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
19846809 CD81 is a useful addition to a panel for precursor B-cell acute lymphoblastic leukemia minimal residual disease detection by flow cytometry.
19830727 Data show that stimulation of the NK cell-expressed tetraspanin CD81 induces phosphorylation of ezrin/radixin/moesin proteins and leads to NK cell polarization thereby facilitating NK cell migration toward various chemokines/cytokines.
19828092 CD81 up-regulation can increase the risk of hepatitis C virus, particularly in HIV-infected subjects.
19817957 Observational study of gene-disease association. (HuGE Navigator)
19802344 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
19773279 Observational study of gene-disease association. (HuGE Navigator)
19755988 Tetraspanin-induced death of myeloma cell lines is autophagic and involves increased UPR signalling.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19654214 CD81-induced ezrin tyrosine phosphorylation required activation of spleen tyrosine kinase.
19626614 293-ADI1-CD81 cells are permissive for serum-derived HCV infection.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19602278 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
19573080 Observational study of gene-disease association. (HuGE Navigator)
19559406 Levels of CD81 expressed in A431 cells are much higher than those expressed in KB cells and motility of A431 cells is also much higher than that of KB cells.
19476617 Association of CD81 with tetraspanin-enriched microdomains is not essential for the early steps of HCV life cycle.
19458002 CD9, CD81 and CD63 are negative regulators of HIV-1-induced cell-cell fusion.
19458002 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
19426143 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
19328198 mutation of juxtamembrane cysteines alters the interaction of CD81 with other proteins, either because of reduced palmitoylation or structural alterations in the mutant proteins, affecting the CD81 microenvironment on the cell surface
19284574 Co-immunoprecipitation experiments showed that Gag proteins interact, directly or indirectly, with CD81, and less with CD82, in tetraspanin-enriched microdomains composed of CD81/CD82/CD63
19284574 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19148942 Hepatitis C infections can be blocked by specific antibodies against putative coreceptors CD81 in a dose-dependent manner.
19030166 CD81 is indispensable for an authentic in vivo hepatitis C virus infection.
18981120 tetraspanins regulate the activity of ADAM10 toward several substrates
18945959 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
18829747 mutation of E2 at position 451 alters the relationship between particle density and infectivity, disrupts coreceptor dependence, and increases virion sensitivity to receptor mimics and neutralizing antibodies
18805782 Endothelial CD81 upregulated in early human atheroma has the potential to play a crucial role in the initial stages of atherosclerotic plaque formation by increasing monocyte adhesion prior to the full-blown inflammatory response.
18799285 HCV envelope glycoprotein E2 can bind to CD81 receptors which are expressed on thyroid cells and induce a cascade of signaling pathway leading to IL-8 release.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18579606 CD81 is a central regulator of cellular events required for hepatitis C virus infection of human hepatocytes.
18566382 hepatitis C virus envelope protein E2 is the only ligand known for CD81
18523555 demonstrated that a combination of high-level expression of CD81 with single-step immunoaffinity purification is a useful method for obtaining large quantities of CD81 membrane receptor suitable for detailed structural analyses of this tetraspanin protein
18466772 CD81 functions as a molecular organizer of membrane microdomains, whereby proteins such as PI4KII control actin remodeling and cell motility, establishing a role for these genes as negative modifiers of oncogenicity and hepatocellular carcinoma
18382656 CD81 partner EWI-2wint inhibits hepatitis C virus entry
18369466 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
18355410 Conformationally correct E2 mutants (Y527 and W529) within the second putative CD81 binding region (amino acids 522-551) disrupted binding of E2 to CD81-GST, suggesting that region 2 is critical to CD81 binding.
18337570 fluorescent protein-tagged forms of CD81 and CLDN1 colocalized.
18321974 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
18076669 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
18059278 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
18034776 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
17989173 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
17942559 CD81 is involved in Hepacivirus infection of human hepatocytes
17941058 CD81-independent routes of cell-cell transmission of hepatitis C virus exist.
17827389 In the plasma membrane, PrP(c) colocalizes with the tetraspanin CD81, sharing the same microdomain.
17522207 Data show that HIV-1 envelope glycoprotein (Env) and core protein (Gag) colocalize strongly with CD63 and CD81 and less strongly with CD9, and suggest that HIV-1 promotes virus assembly and cell-cell transfer by targeting these plasma membrane proteins.
17522207 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
17507469 Results suggest that hepatitis C virus envelope glycoprotein E2 glycans modulate entry, CD81 binding, and neutralization by masking functionally important regions of E2 .
17457918 these data suggested that both HSPG and CD81 are important for HCV entry.
17407154 transferrin receptor and CD9, CD81, and CD9P-1 are differentially sorted into exosomes after TPA treatment of K562 cells
17381240 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
17329343 CD81 expression is an important determinant of hepatitis C virus permissiveness of Huh7 cell clones harboring different characteristics
17194487 CD81 down-regulation on B cells is associated with the response to interferon-alpha-based treatment for chronic hepatitis.
17166843 Association of HTLV-1 Gag protein with tetraspanin-enriched microdomains is mediated by the inner loops of CD81 and CD82.
17079294 These findings support an immunogenic model of hepatitis C virus E2 having three immunogenic domains with distinct structures and functions and provide added support for the idea that CD81 is required for Hepacivirus entry.
17079281 These data indicate that a high density of cell surface-exposed CD81 is a key determinant for productive HCV entry into host cells.
17015697 role of CD81 and CD9 on the cell-to-cell fusion process mediated by HIV-1, syncytia formation induced by HIV-1 envelope proteins and viral entry in human T lymphoblasts
17015697 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
16940516 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
16912317 Specific amino acids conserved in E2 across all genotypes that were critical for CD81 binding were W420, Y527, W529, G530, and D535. These data significantly increase our understanding of the CD81 receptor-E2 binding process.
16735696 Lymphocyte subsets show different patterns of CD81 response before and during antiviral treatment, which are associated with administration of IFN-alpha and antiviral response
16735575 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
16682056 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
16641285 CD81-mediated hepatitis C virus (HCV)pseudoparticle entry entails HCV E2 protein binding to residues in the large extracellular loop as well as molecular events mediated by the transmembrane and intracellular domains of CD81.
16533950 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
16352525 in CD81, numerous membrane-exposed aromatic residues are asymmetrically clustered and protrude on one side of the transmembrane domain
16339892 CD81-mediated activation of B cells in vitro recapitulates the effects of hepatitis C virus binding to B cell CD81 in vivo
15956553 interactions with hepatitis C virus e2 protein may modulate host's innate or adaptive immune response.
15767432 These findings suggest that engagement of CD81 decreases the signaling threshold required to initiate TCR/CD3-mediated induction of integrated HIV-1 proviral DNA in primary CD4+ T cells.
15670777 These results suggest that the LEL has a more robust structure in the intact tetraspanin with regions outside the LEL contributing to CD81 dimerization.
15500552 binding with HCV E2 induces RANTES secretion and internalization of CCR5.
15294858 CD81 expression and HCV core antigen levels in PBMCs are increased in patients with mixed cryoglobulinemia
15280458 CD81, together with additional unknown liver specific receptor(s), mediate the hepacivirus-cell entry process.
15123813 CD81 functions as a post-attachment entry coreceptor and that other cellular factors act in concert with CD81 to mediate hepatitic C virus binding and entry into hepatocytes
14966136 CD81 signaling events could be mediated by 14-3-3 adapter proteins, and these signals may be dependent on cellular redox
14728804 Phage display selection on murine fibroblasts yielded a small peptide specific for HCV receptor human CD81.
14722300 data suggest a functional role for CD81 as a coreceptor for Hepatitis C virus glycoprotein-dependent viral cell entry
14676841 CD81 is linked to ERK/MAPkinase signaling by Shc in liver tumor cells.
14676841 CD81 stimulates synthesis of phosphoinositides with the recruitment of Shc to the plasma membrane via PTB domain, and this sequence of events induces activation of ERK/MAPKinase.
14607925 Coligation of the B cell antigen receptor with the complement (C3)-binding CD21/CD19/CD81 costimulatory complex can enhance the escape of human B cells from Fas-induced death.
12913001 Expression of the CD81 tetraspanin in non-permissive CD81-negative hepato-carcinoma cells was sufficient to restore susceptibility to HCVpp infection, confirming its critical role as a cell attachment factor.
12885763 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
12645944 The costimulatory effects of HCV E2 on T cells depend on CD81 cross-linking that activates Lck through raft aggregation and thus leads to enhanced TCR signaling.
12597781 Signalling through CD81 on T cells costimulates both Th1 and Th2 cells, but increases the number of Th2 cells during long-term activation.
12519228 While CD81 specifically binds to HCV-E2 protein, the entry of HCV into human hepatocytes might be regulated by CD81-unrelated molecule(s).
12492902 two peptides from human CD81 (hCD81) large extra-cellular loop (LEL) with known importance in the hepatitis C virus glycoprotein E2 (HCV-E2) binding interaction was characterized using circular dichroism spectroscopy
12483205 Data show that CD81, a putative receptor for hepatitis C virus, is required on hepatocytes for human Plasmodium falciparum and rodent Plasmodium yoelii sporozoite infectivity.
12471100 CD81 colocalizes at the central zone of the supramolecular activation complex in both T lymphocytes and antigen presenting cells, suggesting a role for CD81 during antigen presentation.
12421929 Release and intercellular trafficking of CD81-positive microparticles regulate the expression of CD81 surface receptors in lymphocytes and play a role in the immune response during infections.
12368358 E2-binding site on CD81 comprises residues Ile(182), Phe(186), Asn(184), and Leu(162)
12210407 Variation of hepatitis C virus load, hypervariable region 1 quasispecies and CD81 hepatocyte expression in hepatocellular carcinoma and adjacent non-cancerous liver.
12209363 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12036870 C-kit is physically associated with transmembrane 4 superfamily proteins CD9, CD63, and CD81, that may negatively modulate c-kit and thus regulate c-kit receptor sensitivity to SLF in hematopoietic progenitors.
11584299 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells
11273649 CD81 regulates neuron-induced astrocyte proliferation via a contact-dependent mechanism.
9685355 HIV-1 Nef is detected in detergent-insoluble AChE+/CD81 low/TSG101 low exosomes, but not in detergent-soluble AChE-/CD81 high/TSG101 high exosomes in Nef-transfected 293T cells

AA Sequence

MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGA      1 - 70
VMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDA     71 - 140
NNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAI    141 - 210
VVAVIMIFEMILSMVLCCGIRNSSVY                                                211 - 236
//

Text Mined References (187)

PMID Year Title
26926492 2016 CD81 and CD48 show different expression on blood eosinophils in systemic sclerosis: new markers for disease and pulmonary inflammation?
26808496 2016 Comparative Proteomics Reveals Important Viral-Host Interactions in HCV-Infected Human Liver Cells.
26498453 2015 Pre-stimulation of CD81 expression by resting B cells increases proliferation following EBV infection, but the overexpression of CD81 induces the apoptosis of EBV-transformed B cells.
26195630 2015 Plasma Membrane Tetraspanin CD81 Complexes with Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) and Low Density Lipoprotein Receptor (LDLR), and Its Levels Are Reduced by PCSK9.
26116703 2015 An intramolecular bond at cluster of differentiation 81 ectodomain is important for hepatitis C virus entry.
26111452 2015 Role of an arginine-lysine rich motif in maturation and trafficking of CD19.
25934191 2015 CD81 and CLDN1 polymorphisms and hepatitis C virus infection susceptibility: a case control study.
25757571 2015 Interferon-? inducible protein 6 impairs EGFR activation by CD81 and inhibits hepatitis C virus infection.
25739915 2015 A mutation in the human tetraspanin CD81 gene is expressed as a truncated protein but does not enable CD19 maturation and cell surface expression.
25701820 2015 Two conserved histidines (His490 and His621) on the E2 glycoprotein of hepatitis C virus are critical for CD81-mediated cell entry.
25656410 2015 Anti-CD81 but not anti-SR-BI blocks Plasmodium falciparum liver infection in a humanized mouse model.
25635054 2015 CD81 promotes both the degradation of transferrin receptor 2 (TfR2) and the Tfr2-mediated maintenance of hepcidin expression.
25568205 2015 Vpu is the main determinant for tetraspanin downregulation in HIV-1-infected cells.
25339761 2015 A view of the E2-CD81 interface at the binding site of a neutralizing antibody against hepatitis C virus.
24990994 2014 Identification of conserved residues in hepatitis C virus envelope glycoprotein E2 that modulate virus dependence on CD81 and SRB1 entry factors.
24965233 2014 CLEC4M-positive and CD81-negative Huh7 cells are not susceptible to JFH-1 HCVcc infection but mediate transinfection.
24733393 2014 The tetraspanin CD81 protein increases melanoma cell motility by up-regulating metalloproteinase MT1-MMP expression through the pro-oncogenic Akt-dependent Sp1 activation signaling pathways.
24667602 2014 Radiation increases the cellular uptake of exosomes through CD29/CD81 complex formation.
24662676 2014 A role for CD81 and hepatitis C virus in hepatoma mobility.
24587404 2014 HIV-1 entry and trans-infection of astrocytes involves CD81 vesicles.
24549717 2014 Generation of infectious HCV pseudo typed particles and its utilization for studying the role of CD81 & SRBI receptors in HCV infection.
24211330 2014 Impact of single nucleotide polymorphisms in the essential HCV entry factor CD81 on HCV infectivity and neutralization.
24130495 2013 Dual function of CD81 in influenza virus uncoating and budding.
24122777 2014 CD81 sequence and susceptibility to hepatitis C infection.
23858057 2013 CD81 controls sustained T cell activation signaling and defines the maturation stages of cognate immunological synapses.
23762099 2013 The association of CD81 polymorphisms with alloimmunization in sickle cell disease.
23704882 2013 Tetraspanins CD81 and CD82 facilitate ?4?1-mediated adhesion of human erythroblasts to vascular cell adhesion molecule-1.
23613949 2013 The CD9/CD81 tetraspanin complex and tetraspanin CD151 regulate ?3?1 integrin-dependent tumor cell behaviors by overlapping but distinct mechanisms.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23498955 2013 HRas signal transduction promotes hepatitis C virus cell entry by triggering assembly of the host tetraspanin receptor complex.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23351194 2013 EWI-2wint promotes CD81 clustering that abrogates Hepatitis C Virus entry.
23349980 2013 Active RNA replication of hepatitis C virus downregulates CD81 expression.
23264468 2013 CD81 regulates cell migration through its association with Rac GTPase.
23264205 2013 CD81 is a candidate tumor suppressor gene in human gastric cancer.
23226274 2012 CD81 interacts with the T cell receptor to suppress signaling.
23126643 2013 Hepatoma polarization limits CD81 and hepatitis C virus dynamics.
22897233 2012 In silico directed mutagenesis identifies the CD81/claudin-1 hepatitis C virus receptor interface.
22855500 2012 Hepatitis C virus induces epidermal growth factor receptor activation via CD81 binding for viral internalization and entry.
22740401 2012 Structural basis of ligand interactions of the large extracellular domain of tetraspanin CD81.
22560863 2012 Significance of palmitoylation of CD81 on its association with tetraspanin-enriched microdomains and mediating hepatitis C virus cell entry.
22355327 2012 Soluble serum CD81 is elevated in patients with chronic hepatitis C and correlates with alanine aminotransferase serum activity.
22333880 2012 Clinical significance of CD81 expression by clonal plasma cells in high-risk smoldering and symptomatic multiple myeloma patients.
22074322 2011 Inhibition of HCV 3a genotype entry through host CD81 and HCV E2 antibodies.
21930792 2011 SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling.
21737455 2011 Hepatitis C virus is primed by CD81 protein for low pH-dependent fusion.
21677313 2011 CD81 is essential for the formation of membrane protrusions and regulates Rac1-activation in adhesion-dependent immune cell migration.
21551950 2011 Expression of human factors CD81, claudin-1, scavenger receptor, and occludin in mouse hepatocytes does not confer susceptibility to HCV entry.
21526201 2011 Hepatitis C virus protects human B lymphocytes from Fas-mediated apoptosis via E2-CD81 engagement.
21428935 2011 Structural characterization of CD81-Claudin-1 hepatitis C virus receptor complexes.
21428934 2011 Hepatitis C virus entry and the tetraspanin CD81.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21343309 2011 Interacting regions of CD81 and two of its partners, EWI-2 and EWI-2wint, and their effect on hepatitis C virus infection.
21276792 2011 Morphologic and proteomic characterization of exosomes released by cultured extravillous trophoblast cells.
21269460 2011 Initial characterization of the human central proteome.
21241315 2011 Tetraspanins CD9 and CD81 are molecular partners of trimeric Fc?RI on human antigen-presenting cells.
21235781 2011 Human saliva, plasma and breast milk exosomes contain RNA: uptake by macrophages.
21151997 2010 Membrane-Associated RING-CH proteins associate with Bap31 and target CD81 and CD44 to lysosomes.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20375010 2010 Claudin association with CD81 defines hepatitis C virus entry.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20237408 2010 CD81 gene defect in humans disrupts CD19 complex formation and leads to antibody deficiency.
20089661 2010 Novel function of CD81 in controlling hepatitis C virus replication.
20004001 2010 CD81 protein is expressed at high levels in normal germinal center B cells and in subtypes of human lymphomas.
19946888 2010 Defining the membrane proteome of NK cells.
19901060 2010 Tetraspanin CD81 is required for Listeria monocytogenes invasion.
19846809 2009 Aberrant underexpression of CD81 in precursor B-cell acute lymphoblastic leukemia: utility in detection of minimal residual disease by flow cytometry.
19830727 2009 Regulation of NK cell trafficking by CD81.
19828092 CD81 expression on CD19+ peripheral blood lymphocytes is associated with chronic HCV disease and increased risk for HCV infection: a putative role for inflammatory cytokines.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19755988 2009 Tetraspanin-induced death of myeloma cell lines is autophagic and involves increased UPR signalling.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19654214 2009 Engagement of CD81 induces ezrin tyrosine phosphorylation and its cellular redistribution with filamentous actin.
19626614 2009 293 cells over-expressing human ADI1 and CD81 are permissive for serum-derived hepatitis C virus infection.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19559406 2009 Control of cell motility by interaction of gangliosides, tetraspanins, and epidermal growth factor receptor in A431 versus KB epidermoid tumor cells.
19476617 2009 The association of CD81 with tetraspanin-enriched microdomains is not essential for Hepatitis C virus entry.
19458002 2009 Formation of syncytia is repressed by tetraspanins in human immunodeficiency virus type 1-producing cells.
19328198 2009 Mutation of juxtamembrane cysteines in the tetraspanin CD81 affects palmitoylation and alters interaction with other proteins at the cell surface.
19284574 2009 A role for CD81 on the late steps of HIV-1 replication in a chronically infected T cell line.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19148942 2009 Development and characterization of hepatitis C virus genotype 1-7 cell culture systems: role of CD81 and scavenger receptor class B type I and effect of antiviral drugs.
19088272 2009 CD81 is dispensable for hepatitis C virus cell-to-cell transmission in hepatoma cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19030166 2008 Anti-CD81 antibodies can prevent a hepatitis C virus infection in vivo.
19028452 2009 Proteomic profiling of human plasma exosomes identifies PPARgamma as an exosome-associated protein.
18981120 2008 Tetraspanins regulate ADAM10-mediated cleavage of TNF-alpha and epidermal growth factor.
18829747 2008 Identification of a residue in hepatitis C virus E2 glycoprotein that determines scavenger receptor BI and CD81 receptor dependency and sensitivity to neutralizing antibodies.
18805782 2009 Endothelial CD81 is a marker of early human atherosclerotic plaques and facilitates monocyte adhesion.
18799285 2008 HCV E2 protein binds directly to thyroid cells and induces IL-8 production: a new mechanism for HCV induced thyroid autoimmunity.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18579606 2008 CD81 is a central regulator of cellular events required for hepatitis C virus infection of human hepatocytes.
18566382 2008 Coligation of the hepatitis C virus receptor CD81 with CD28 primes naive T lymphocytes to acquire type 2 effector function.
18523555 2008 High-level expression, single-step immunoaffinity purification and characterization of human tetraspanin membrane protein CD81.
18466772 2008 Tetraspanin CD81-regulated cell motility plays a critical role in intrahepatic metastasis of hepatocellular carcinoma.
18382656 2008 The CD81 partner EWI-2wint inhibits hepatitis C virus entry.
18355410 2008 Dissecting the role of putative CD81 binding regions of E2 in mediating HCV entry: putative CD81 binding region 1 is not involved in CD81 binding.
18337570 2008 CD81 and claudin 1 coreceptor association: role in hepatitis C virus entry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17942559 2008 Serum-derived hepatitis C virus infection of primary human hepatocytes is tetraspanin CD81 dependent.
17941058 2008 Hepatitis C virus cell-cell transmission in hepatoma cells in the presence of neutralizing antibodies.
17827389 2007 Normal prion protein trafficking in cultured human erythroblasts.
17784784 2007 Reliance of host cholesterol metabolic pathways for the life cycle of hepatitis C virus.
17522207 2007 Human immunodeficiency virus type 1 assembly, budding, and cell-cell spread in T cells take place in tetraspanin-enriched plasma membrane domains.
17507469 2007 Hepatitis C virus envelope glycoprotein E2 glycans modulate entry, CD81 binding, and neutralization.
17457918 2007 The roles of CD81 and glycosaminoglycans in the adsorption and uptake of infectious HCV particles.
17407154 2007 The transferrin receptor and the tetraspanin web molecules CD9, CD81, and CD9P-1 are differentially sorted into exosomes after TPA treatment of K562 cells.
17329343 2007 CD81 expression is important for the permissiveness of Huh7 cell clones for heterogeneous hepatitis C virus infection.
17194487 2007 CD81 down-regulation on B cells is associated with the response to interferon-alpha-based treatment for chronic hepatitis C virus infection.
17166843 2007 The inner loop of tetraspanins CD82 and CD81 mediates interactions with human T cell lymphotrophic virus type 1 Gag protein.
17079294 2007 Immunogenic and functional organization of hepatitis C virus (HCV) glycoprotein E2 on infectious HCV virions.
17079281 2007 The level of CD81 cell surface expression is a key determinant for productive entry of hepatitis C virus into host cells.
17015697 2006 Tetraspanins CD9 and CD81 modulate HIV-1-induced membrane fusion.
16912317 2006 Identification of conserved residues in the E2 envelope glycoprotein of the hepatitis C virus that are critical for CD81 binding.
16735696 2006 Dynamics of CD81 expression on lymphocyte subsets during interferon-alpha-based antiviral treatment of patients with chronic hepatitis C.
16641285 2006 Different domains of CD81 mediate distinct stages of hepatitis C virus pseudoparticle entry.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16352525 2006 Complete predicted three-dimensional structure of the facilitator transmembrane protein and hepatitis C virus receptor CD81: conserved and variable structural domains in the tetraspanin superfamily.
16339892 2005 Activation of naïve B lymphocytes via CD81, a pathogenetic mechanism for hepatitis C virus-associated B lymphocyte disorders.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15956553 2005 Hepatitis C virus E2-CD81 interaction induces hypermutation of the immunoglobulin gene in B cells.
15908444 2005 Exosomal-like vesicles are present in human blood plasma.
15767432 2005 Tetraspanin CD81 provides a costimulatory signal resulting in increased human immunodeficiency virus type 1 gene expression in primary CD4+ T lymphocytes through NF-kappaB, NFAT, and AP-1 transduction pathways.
15670777 2005 Determinants of CD81 dimerization and interaction with hepatitis C virus glycoprotein E2.
15500552 2004 Binding of HCV E2 to CD81 induces RANTES secretion and internalization of CC chemokine receptor 5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15294858 2004 Association of HCV-related mixed cryoglobulinemia with specific mutational pattern of the HCV E2 protein and CD81 expression on peripheral B lymphocytes.
15280458 2004 Diverse hepatitis C virus glycoproteins mediate viral infection in a CD81-dependent manner.
15123813 2004 CD81 is an entry coreceptor for hepatitis C virus.
15004227 2004 Dynamic regulation of a GPCR-tetraspanin-G protein complex on intact cells: central role of CD81 in facilitating GPR56-Galpha q/11 association.
14966136 2004 CD81 associates with 14-3-3 in a redox-regulated palmitoylation-dependent manner.
14728804 2003 Phage display selection on whole cells yields a small peptide specific for HCV receptor human CD81.
14722300 2004 CD81 is required for hepatitis C virus glycoprotein-mediated viral infection.
14676841 2004 Tetraspanin CD81 is linked to ERK/MAPKinase signaling by Shc in liver tumor cells.
14607925 2003 Role of complement-binding CD21/CD19/CD81 in enhancing human B cell protection from Fas-mediated apoptosis.
12970454 2003 CD81-dependent binding of hepatitis C virus E1E2 heterodimers.
12913001 2003 Cell entry of hepatitis C virus requires a set of co-receptors that include the CD81 tetraspanin and the SR-B1 scavenger receptor.
12645944 2003 T cell costimulation by the hepatitis C virus envelope protein E2 binding to CD81 is mediated by Lck.
12604806 2003 Analysis of the subcellular localization of hepatitis C virus E2 glycoprotein in live cells using EGFP fusion proteins.
12597781 2003 Human CD81 directly enhances Th1 and Th2 cell activation, but preferentially induces proliferation of Th2 cells upon long-term stimulation.
12522210 2003 Identification of a lactoferrin-derived peptide possessing binding activity to hepatitis C virus E2 envelope protein.
12519228 2003 In vitro binding of hepatitis C virus to CD81-positive and -negative human cell lines.
12492902 2003 Structural characterization of peptide fragments from hCD81-LEL.
12483205 2003 Hepatocyte CD81 is required for Plasmodium falciparum and Plasmodium yoelii sporozoite infectivity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471100 2002 Cutting edge: dynamic redistribution of tetraspanin CD81 at the central zone of the immune synapse in both T lymphocytes and APC.
12437138 2002 Subunit association and conformational flexibility in the head subdomain of human CD81 large extracellular loop.
12421929 2002 Release and intercellular transfer of cell surface CD81 via microparticles.
12368358 2002 Identification of the hepatitis C virus E2 glycoprotein binding site on the large extracellular loop of CD81.
12210407 2002 Variation of hepatitis C virus load, hypervariable region 1 quasispecies and CD81 hepatocyte expression in hepatocellular carcinoma and adjacent non-cancerous liver.
12209363 2002 Association of low-density lipoprotein receptor polymorphisms and outcome of hepatitis C infection.
12036870 2002 C-kit associated with the transmembrane 4 superfamily proteins constitutes a functionally distinct subunit in human hematopoietic progenitors.
11781364 2002 Binding of the hepatitis C virus envelope protein E2 to CD81 inhibits natural killer cell functions.
11781363 2002 Inhibition of natural killer cells through engagement of CD81 by the major hepatitis C virus envelope protein.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
11673522 2001 PGRL is a major CD81-associated protein on lymphocytes and distinguishes a new family of cell surface proteins.
11504738 2001 EWI-2 is a major CD9 and CD81 partner and member of a novel Ig protein subfamily.
11278880 2001 The major CD9 and CD81 molecular partner. Identification and characterization of the complexes.
11273649 2001 CD81 regulates neuron-induced astrocyte cell-cycle exit.
11226150 2001 CD81 extracellular domain 3D structure: insight into the tetraspanin superfamily structural motifs.
11087758 2001 FPRP, a major, highly stoichiometric, highly specific CD81- and CD9-associated protein.
10459022 1999 Role of transmembrane 4 superfamily (TM4SF) proteins CD9 and CD81 in muscle cell fusion and myotube maintenance.
10400713 1999 Characterization of hepatitis C virus E2 glycoprotein interaction with a putative cellular receptor, CD81.
10229664 1999 Selective tetraspan-integrin complexes (CD81/alpha4beta1, CD151/alpha3beta1, CD151/alpha6beta1) under conditions disrupting tetraspan interactions.
9794763 1998 Binding of hepatitis C virus to CD81.
9403053 1997 A 2.5-Mb transcript map of a tumor-suppressing subchromosomal transferable fragment from 11p15.5, and isolation and sequence analysis of three novel genes.
9360996 1997 NAG-2, a novel transmembrane-4 superfamily (TM4SF) protein that complexes with integrins and other TM4SF proteins.
9360995 1997 Generation of monoclonal antibodies to integrin-associated proteins. Evidence that alpha3beta1 complexes with EMMPRIN/basigin/OX47/M6.
9168119 1997 Dimeric association and segmental variability in the structure of human CD4.
8816400 1996 Supramolecular complexes of MHC class I, MHC class II, CD20, and tetraspan molecules (CD53, CD81, and CD82) at the surface of a B cell line JY.
8630057 1996 CD63 associates with transmembrane 4 superfamily members, CD9 and CD81, and with beta 1 integrins in human melanoma.
8168850 1994 Chromosomal localization of three human genes coding for A15, L6, and S5.7 (TAPA1): all members of the transmembrane 4 superfamily of proteins.
8039242 1994 Mouse homologue of C33 antigen (CD82), a member of the transmembrane 4 superfamily: complementary DNA, genomic structure, and expression.
7690834 1993 Functional dissection of the CD21/CD19/TAPA-1/Leu-13 complex of B lymphocytes.
2398277 1990 TAPA-1, the target of an antiproliferative antibody, is associated on the cell surface with the Leu-13 antigen.
1860863 1991 Structure and membrane topology of TAPA-1.
1695320 1990 TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins.
1650385 1991 Genomic organization and chromosomal localization of the TAPA-1 gene.
1383329 1992 The CD19/CD21 signal transducing complex of human B lymphocytes includes the target of antiproliferative antibody-1 and Leu-13 molecules.