Property Summary

NCBI Gene PubMed Count 66
PubMed Score 343.52
PubTator Score 181.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
pituitary cancer 1915 1.3e-11
osteosarcoma 7766 7.1e-10
nasopharyngeal carcinoma 1024 1.1e-03
interstitial cystitis 2237 4.8e-03
Disease Target Count Z-score Confidence
Immune system cancer 136 0.0 0.6
Lymphoid leukemia 156 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2388 4.114 2.1
Macroglobulinemia 17 3.396 1.7
Obesity 655 3.334 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis 1.900 4.8e-03
nasopharyngeal carcinoma -1.600 1.1e-03
osteosarcoma -3.654 7.1e-10
pituitary cancer -3.600 1.3e-11

 GWAS Trait (1)

Gene RIF (34)

AA Sequence

MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSA      1 - 70
SGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTEL     71 - 140
RVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDI    141 - 210
VTLRTGEVKWSVGEHPGQE                                                       211 - 229
//

Text Mined References (72)

PMID Year Title