Property Summary

NCBI Gene PubMed Count 64
PubMed Score 28259.40
PubTator Score 1341.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Agammaglobulinemia 34 6.068 3.0
Lymphoma, Large B-Cell, Diffuse 34 0.0 0.0
Disease Target Count Z-score Confidence
Celiac disease 116 7.586 3.8
Immunoglobulin alpha deficiency 11 7.337 3.7
Kidney disease 430 6.95 3.5
Henoch-Schoenlein purpura 12 6.755 3.4
Dermatitis 157 6.301 3.2
Cancer 2499 5.99 3.0
Vasculitis 80 5.952 3.0
Influenza 142 5.888 2.9
Purpura 43 5.767 2.9
Bullous pemphigoid 18 5.71 2.9
Lupus erythematosus 57 5.653 2.8
Allergic hypersensitivity disease 126 5.633 2.8
Rheumatoid arthritis 1191 5.626 2.8
Epidermolysis bullosa acquisita 10 5.532 2.8
Anemia 365 5.502 2.8
Toxoplasmosis 17 5.47 2.7
Cholera 34 5.469 2.7
Tetanus 68 5.426 2.7
Inflammatory bowel disease 151 5.391 2.7
Pneumonia 174 5.322 2.7
Liver disease 237 5.236 2.6
Chlamydia 21 5.215 2.6
Pertussis 20 5.214 2.6
Otitis Media 52 5.158 2.6
Dental caries 164 5.12 2.6
Gastroenteritis 41 5.014 2.5
Heavy chain disease 6 4.984 2.5
Tonsillitis 16 4.883 2.4
Giardiasis 9 4.864 2.4
Typhoid fever 22 4.851 2.4
Bronchitis 43 4.798 2.4
Exanthem 37 4.729 2.4
Acquired immunodeficiency syndrome 197 4.707 2.4
Asthma 385 4.683 2.3
Macroglobulinemia 18 4.683 2.3
Ankylosing spondylitis 140 4.667 2.3
Periodontal disease 40 4.65 2.3
Cryoglobulinemia 18 4.645 2.3
Gastritis 47 4.616 2.3
tuberculosis 2010 4.545 2.3
POEMS syndrome 6 4.529 2.3
Infectious mononucleosis 14 4.496 2.2
Antiphospholipid syndrome 19 4.461 2.2
Autoimmune hemolytic anemia 31 4.453 2.2
Eye disease 62 4.422 2.2
Dysentery 10 4.414 2.2
Reactive arthritis 7 4.377 2.2
Rubella 15 4.369 2.2
Shigellosis 21 4.369 2.2
Diphtheria 40 4.356 2.2
Polyneuropathy 64 4.338 2.2
Rhinitis 54 4.304 2.2
Infertility 188 4.256 2.1
Schistosomiasis 35 4.213 2.1
Leukopenia 72 4.212 2.1
Bronchiectasis 64 4.206 2.1
Neuropathy 261 4.204 2.1
Meningitis 67 4.201 2.1
Thrombocytopenia 197 4.188 2.1
Amyloidosis 67 4.167 2.1
Hypertension 396 4.163 2.1
Chickenpox 8 4.158 2.1
Amebiasis 21 4.145 2.1
interstitial lung disease 298 4.114 2.1
diabetes mellitus 1728 4.111 2.1
Salmonellosis 42 4.071 2.0
Hypereosinophilic syndrome 71 4.068 2.0
Inclusion conjunctivitis 8 4.064 2.0
Measles 22 4.057 2.0
Dysgammaglobulinemia 10 4.034 2.0
Lymphadenitis 15 3.998 2.0
Mumps 10 3.992 2.0
X-linked hyper IgM syndrome 4 3.966 2.0
Herpes simplex 18 3.931 2.0
Hepatitis B 108 3.902 2.0
Candidiasis 55 3.901 2.0
Cryptosporidiosis 13 3.893 1.9
Sjogren's syndrome 26 3.867 1.9
Guillain-Barre syndrome 14 3.854 1.9
Q fever 15 3.853 1.9
Brucellosis 24 3.828 1.9
Brain disease 96 3.82 1.9
Lichen planus 16 3.814 1.9
Lymphoproliferative syndrome 58 3.807 1.9
Prostatitis 18 3.801 1.9
psoriasis 6694 3.8 1.9
Urethritis 10 3.795 1.9
Ataxia telangiectasia 34 3.785 1.9
Acute cystitis 35 3.781 1.9
Polyclonal hypergammaglobulinemia 5 3.78 1.9
Syphilis 17 3.721 1.9
Collagen disease 27 3.717 1.9
Heart disease 306 3.678 1.8
sarcoidosis 370 3.637 1.8
Strongyloidiasis 9 3.623 1.8
Autoimmune thyroiditis 27 3.619 1.8
Rheumatic disease 8 3.615 1.8
Autoimmune hepatitis 11 3.608 1.8
Cholangitis 32 3.608 1.8
Aspergillosis 26 3.605 1.8
Leprosy 73 3.605 1.8
Stomatitis 21 3.603 1.8
Irritable bowel syndrome 60 3.6 1.8
Erythema multiforme 17 3.599 1.8
Meningoencephalitis 13 3.585 1.8
Urticaria 67 3.579 1.8
Coronary artery disease 268 3.559 1.8
cystic fibrosis 1696 3.537 1.8
Herpes gestationis 6 3.495 1.7
Dyspepsia 33 3.49 1.7
Multiple Sclerosis 540 3.485 1.7
Autoimmune thrombocytopenic purpura 13 3.471 1.7
Atherosclerosis 291 3.443 1.7
Parotitis 6 3.433 1.7
Duodenitis 7 3.431 1.7
Trichomoniasis 10 3.42 1.7
Bacteriuria 8 3.409 1.7
Hepatitis A 11 3.375 1.7
Herpes zoster 68 3.347 1.7
Bronchiolitis 18 3.34 1.7
Goodpasture syndrome 6 3.336 1.7
Paratyphoid fever 10 3.329 1.7
Cervicitis 6 3.319 1.7
Common cold 67 3.304 1.7
Arthropathy 43 3.279 1.6
Down syndrome 499 3.278 1.6
Salpingitis 6 3.254 1.6
Myositis 30 3.25 1.6
Echinococcosis 26 3.246 1.6
Pneumocystosis 17 3.228 1.6
Newcastle disease 14 3.223 1.6
Cholestasis 155 3.222 1.6
Intussusception 5 3.204 1.6
Poliomyelitis 14 3.191 1.6
Chronic fatigue syndrome 25 3.168 1.6
protein-energy malnutrition 8 3.146 1.6
Duodenal ulcer 20 3.141 1.6
Vaginitis 4 3.138 1.6
Graves' disease 24 3.131 1.6
Lymphogranuloma venereum 11 3.122 1.6
Pelvic inflammatory disease 21 3.091 1.5
Rheumatic fever 19 3.086 1.5
Wiskott-Aldrich syndrome 30 3.082 1.5
Severe combined immunodeficiency 51 3.069 1.5
Leishmaniasis 47 3.059 1.5
Monoclonal paraproteinemia 2 3.057 1.5
Pharyngitis 17 3.049 1.5
Rosacea 25 3.044 1.5
Constipation 181 3.031 1.5
Lyme disease 26 3.016 1.5

Expression

  Differential Expression (11)

Disease log2 FC p
chronic rhinosinusitis 1.110 2.7e-02
cutaneous lupus erythematosus 2.400 3.7e-02
cystic fibrosis and chronic rhinosinusit... 1.162 2.3e-02
gastric cancer -1.400 4.3e-02
interstitial cystitis 2.500 1.6e-03
intraductal papillary-mucinous carcinoma... -1.300 5.2e-03
lung adenocarcinoma 1.900 2.5e-11
non-small cell lung carcinoma 1.600 1.3e-15
osteosarcoma -2.193 4.7e-05
periodontitis 2.000 8.3e-28
ulcerative colitis 1.800 6.8e-03

Gene RIF (23)

AA Sequence

MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVL      1 - 70
HGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGT     71 - 140
KNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTY    141 - 210
QDVGSLNIGDVQLEKP                                                          211 - 226
//

Text Mined References (69)

PMID Year Title