Property Summary

NCBI Gene PubMed Count 115
PubMed Score 272.62
PubTator Score 193.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
Rheumatoid Arthritis -2.900 1.4e-03
astrocytoma 3.300 1.4e-03
posterior fossa group A ependymoma 1.800 5.0e-03
esophageal adenocarcinoma 1.400 1.9e-02
psoriasis -1.600 3.8e-03
glioblastoma 3.200 1.4e-03
osteosarcoma -1.863 4.6e-02
atypical teratoid / rhabdoid tumor 1.500 2.1e-03
Duchenne muscular dystrophy 1.553 2.3e-09
limb girdle muscular dystrophy 2I 1.293 3.7e-04
Becker muscular dystrophy 1.160 1.2e-03
juvenile dermatomyositis 1.453 5.5e-08
adrenocortical carcinoma -1.642 2.2e-02
pancreatic ductal adenocarcinoma liver m... 2.313 2.4e-03
non-small cell lung cancer -1.217 4.0e-06
lung cancer -3.800 2.6e-07
active Crohn's disease 3.781 6.4e-04
active ulcerative colitis 3.929 1.2e-04
interstitial cystitis 1.500 1.7e-02
pediatric high grade glioma 2.100 4.4e-03
pilocytic astrocytoma 2.600 6.3e-05
primary Sjogren syndrome 2.100 5.0e-02
subependymal giant cell astrocytoma 2.101 4.6e-03
Breast cancer 1.300 3.3e-02
invasive ductal carcinoma 1.479 2.5e-03
lung carcinoma -2.700 4.7e-43
acute myeloid leukemia 1.200 4.1e-02
ovarian cancer 2.100 8.5e-06
Down syndrome 1.800 9.2e-04

Gene RIF (101)

PMID Text
27033518 Studies indicate that the invariant chain (CD74) is critical for antigen presentation.
26500140 FOXP1 represents a novel regulator of genes targeted by the class II MHC transactivator CIITA and CD74.
26412712 an inverse correlation with the tumor size for stromal MIF and a positive correlation with the triple receptor negative tumor status for stromal CD74 seem to be showed
26198699 Invariant chain is a new chaperone for TLR7 in B cells. (Review)
26039541 Interferon gamma promotes melanoma cell survival regulating CD74-MIF interaction.
25998395 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
25983110 A conserved WW domain-like motif regulates CD74 antigen-dependent cell-surface transport of the NKG2D ligand ULBP2.
25600560 CD74 expression and its therapeutic potential in thyroid carcinoma
25304249 Specific targeting of the CD74 on the lymphoma cell surface will sensitize CD74-expressing cancer cells to Fas-mediated apoptosis.
25175718 The results of this stusy suggested that the CD74 represents a positive prognostic marker most probably because of its association with an M1-polarized immune milieu in high-grade gliomas.
25172501 In TPA-induced skin inflammation, MIF is released from damaged keratinocytes and then triggers the chemotaxis of CD74(+)CXCR2(+) NKT cells for IFN-gamma production.
25035924 In human B cells, SPPL2a is indispensable for turnover of CD74 N-terminal fragment.
24939415 Findings showed an increased extent of MIF expression in cancer cells and in stromal fibroblasts of Breast Cancer tumor, in contrast to a less uniform increase of CD74 expression.
24904546 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
24731748 demonstrate that CLIP expression on leukemia-associated phenotype (LAP)-positive cells during follow-up is significantly correlated with a shortened relapse-free survival
24683185 These results demonstrate natural antagonist activity of DRalpha1 for macrophage migration inhibitory factor
24663824 High CD74 expression is associated with head and neck squamous cell carcinomas.
24638068 these results demonstrate that the subunit stoichiometry of oligomeric Ii/MHCII complexes is influenced by p35.
24594996 High expression of CD74 is an independent prognostic factor for prolonged overall survival in mesothelioma patients
24569872 MIF/CD74 pathway may represent a crucial target for treating disc degeneration since inhibiting the function of MIF with its antagonist ISO-1 can reduce MIF-induced inflammation and exert potent therapeutic effects.
24495362 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
24469108 Results show that CD74-NRG1 gene fusions are activating genomic alterations in invasive mucinous lung adenocarcinomas.
24220096 Polymorphisms in CD74 is associated with hematologic toxicity in patients with non-small-cell lung cancer after platinum-based chemotherapy.
24205828 Recombinant vaccinia virus vaccines encoding CD74 may be useful tools to improve CD4 T-cell responses to viral and tumour antigens.
24035804 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
23730214 when CD74 is overexpressed in human cancer and noncancerous epithelial cells, it interacts and interferes with the function of Scribble
23572149 Evaluated expression of CD74 in chronic lymphocytic leukemia patients. CD74 expression was significantly higher in CLL group than in controls. There was positive correlation between CD74 and ZAP70 expression.
23289738 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
23273913 Data show that clear cell renal cell carcinoma (ccRCC) tissue and malignant cell lines expressed higher levels of CD74 and hypoxia inducible factor 1alpha (HIF-1alpha) than adjacent normal renal tissue and normal cell HK-2.
23000905 Our data do not replicate prior reports of LN-2 as a sensitive and specific marker for undifferentiated pleomorphic sarcoma
22952837 a novel regulatory mechanism governing cell migration during intervertebral disc degeneration
22942358 Ii regulates the repertoire of tumor peptides presented by major histocompatibility complex class II+ breast cancer cells.
22935920 High Cd74 expression is associated with lymph node metastasis and triple-negative breast cancer.
22905972 CD74 antigen expression is increased in high grade, invasive urothelial bladder cancer.
22889831 Data indicate that 25 +/- 1.3% of CD74 and 17 +/- 0.3% of HLA-DR are colocalized.
22761382 Hepatitis C virus-mediated inhibition of cathepsin S increases invariant-chain expression on hepatocyte surface.
22689013 Data show that human Iip35 isoform (CD74 antigen) is expressed in mouse antigen presenting cells.
22659450 Expression of CD74-ROS in noninvasive NSCLC cell lines readily conferred invasive properties that paralleled the acquisition of E-Syt1 phosphorylation.
22611320 Upregulation of MIF, CD74 and TLR4 are associated with increasing clinical stage and provide an opportunity as novel gastric cancer chemoprevention and/or treatment strategy.
22216005 Epstein-Barr virus evades CD4+ T cell responses in lytic cycle through BZLF1-mediated downregulation of CD74 and the cooperation of vBcl-2.
22178447 Stat1 and CD74 overexpression is co-dependent and linked to increased invasion and lymph node metastasis in triple-negative breast cancer.
22069105 Class I homozygosity at 5'VNTR is a significant risk factor of T1DM and acts independently from HLA haplotype in determining the actual risk of diabetes in children.
22042694 Data show that FTY720-mediated disruption of the autophagic-lysosomal pathway led to increased levels of CD74, a potential therapeutic target in mantle cell lymphoma (MCL) that is degraded in the lysosomal compartment.
22039051 HIV-1 glycoprotein 41 ectodomain induces activation of the CD74 protein-mediated extracellular signal-regulated kinase/mitogen-activated protein kinase pathway to enhance viral infection.
22039051 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
21945129 This is the first study reporting that Ii chain up-regulation occurs on naturally infected antigen presenting cells obtained directly from HIV(+) subjects.
21922073 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
21792010 overexpression of MIF and CD74 in cervical squamous cell carcinomas and its precancerous lesions and upregulation of VEGF secretion in cervical cancer cells indicate MIF and CD74 may play critical roles in pathogenesis and angiogenesis of cervical cancer
21748758 These results suggest that cancer cells in the PNI areas could acquired a growth advantage that could be triggered by the growth factor receptors EGFR and CD74.
21543057 CatG was found to be dispensable in invariant chain conversion within intact primary human B cells and dendritic cells.
21423200 Synergistic TLR agonist stimulation in combination with IFN-alpha and IFN-gamma was the best method for regulating CD38 and CD74 expression
21417823 Studies indicate that in chronic lymphocytic leukemia cells, binding of MIF to CD74 induces nuclear factor-kappaB activation and up-regulation of TAp63 expression, resulting in the secretion of interleukin 8, which in turn promotes cell survival.
21228923 These findings are supportive of a role for CD74 in the development and maintenance of gastrointestinal neoplasia.
21068258 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
20864512 Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator)
20820776 Simultaneous inhibition of TAP and Ii completely down-modulated the expression of HLA-DR, demonstrating that together these molecules form the key mediators of HLA class II antigen presentation in leukemic blasts.
20646540 Overexpression of MIF and CD74 in the placenta may up-regulate the CRP level in maternal blood, which may be involved in the pathogenesis of preeclampsia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20463068 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
20443131 CD74 is expressed in a subset of high grade gliomas and may contribute to temozolomide resistance
20357260 CD74 and its target gene transcripts (TA)p63 and very late antigen (VLA)-4 facilitate migration of chronic lymphocytic leukemia cells back to the bone marrow (BM), where they interact with the supportive BM environment that rescues them from apoptosis.
20198449 CD74 activation inhibits in a dose-dependent manner up to 90% of in vitro migration of MSCs, with consistent effects observed among multiple MSC donor preparations.
20012522 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
19913121 Observational study of gene-disease association. (HuGE Navigator)
19845895 Observational study of gene-disease association. (HuGE Navigator)
19665027 Data show that CD74 forms functional complexes with CXCR4 that mediate MIF-specific signaling.
19592662 at late stages of Vaccinia virus infection, reductions in cellular invariant chain levels coupled with changes in lysosomal protease activity, contribute in part to defects in class II presentation
19423618 CD74 levels are increased in plaques and PBMC from patients with carotid stenosis and are associated with intima-medial thickness in subjects free from clinical cardiovascular diseases.
19327048 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
19131591 We found intense CD74 expression by immunohistochemistry in 57 of 70 human specimens of non-small cell lung cancer
18941249 Increased expression of CD74 can enhance kidney cancer cell proliferation, anchorage independence, invasion, and tumor cell-induced human umbilical vein endothelial cell migration in vitro as well as tumor growth and metastasis in vivo.
18842989 CD74 acts as a receptor for MIF in podocytes and may play a role in the pathogenesis of diabetic nephropathy
18828016 Expression of Ii by breast tumor cells may quantitatively and qualitatively alter the presentation of antigens on those cells.
18719072 The observations indicate that CD74 and the AGTR1 become associated in the early biosynthetic pathway, and that CD74 is a negative regulator of AGTR1 expression.
18684948 This study provides several lines of evidence to demonstrate the complex interactions of major histocompatibility (MHC) class II invariant chain (Ii) with neonatal Fc receptor for IgG (FcRn).
18596106 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
18524831 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
18438604 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
18178838 These findings identify Ii and lipid rafts as key regulators of CD1a organization on the surface of immature DCs and of its immunological function as Ag-presenting molecule
17959659 The cytoplasmic region of Vpu was found to interact with the 30-amino-acid cytoplasmic tail of CD74.
17959659 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
17567581 analysis of interaction between a secreted hookworm Macrophage Migration Inhibitory Factor (MIF) and the human MIF receptor CD74
17142775 Prostate cancer cell lines had increased MIF gene expression and protein levels; cell growth and invasion required MIF activated signal transduction pathways that were not necessary for growth or viability of androgen-dependent prostate cells
16678175 Ii can also be detected in the class I MHC peptide loading complex.
16618111 link the disruption of transmembrane helix interactions to previously reported losses of invariant chain function
16542748 Residues favoring AP3 binding introduced into a protein that is transported via the PM such as the invariant chain can re-route such protein into direct sorting to late endosomal/lysosomal structures.
16454711 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
16439540 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
16428763 H. pylori urease B binds to CD74 on gastric epithelial cells and initiates NF-kappaB activation and interleukin-8 production.
16365153 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
16107560 We demonstrate that CD74-ICD translocates to the nucleus and induces the activation of the p65 member of NF-kappaB in this compartment.
15972644 CD74 is expressed on the surface of gastric cells, and Helicobacter pylori can use this receptor as a point of attachment to gastric epithelial cells, which lead to IL-8 production.
15845476 H.pylori binds to CD74 on gastric epithelial cells & stimulates interleukin-8 production; binding of H. pylori to CD74 presents a novel insight into an interaction of H. pylori with the gastric epithelium leading to upregulation of inflammatory responses
15688398 Downregulation of HLA-DG is associated with early intrahepatic recurrence of hepatocellular carcinoma
15475450 CD74 represents a novel and promising target for treatment of multiple myeloma.
15194762 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
12970439 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
12782713 MIF binds to the extracellular domain of CD74, and CD74 is required for MIF-induced activation of the extracellular signal-regulated kinase-1/2 MAP kinase cascade
12058053 its cytoplasmic tail regulates endosome fusion and morphology
11897800 Coordinate expression of Ii/CD74 and MHC class II antigens was identified in most fetal tissues
11593029 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection

AA Sequence

MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYF      1 - 70
LYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTED     71 - 140
HVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVL    141 - 210
TKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDP    211 - 280
SSGLGVTKQDLGPVPM                                                          281 - 296
//

Text Mined References (124)

PMID Year Title
27033518 2016 The multifaceted roles of the invariant chain CD74--More than just a chaperone.
26500140 2016 FOXP1 suppresses immune response signatures and MHC class II expression in activated B-cell-like diffuse large B-cell lymphomas.
26412712 2015 Macrophage migration inhibitory factor involvement in breast cancer (Review).
26198699 2015 Invariant chain is a new chaperone for TLR7 in B cells.
26039541 2015 Cell Surface CD74-MIF Interactions Drive Melanoma Survival in Response to Interferon-?.
25983110 2015 A conserved WW domain-like motif regulates invariant chain-dependent cell-surface transport of the NKG2D ligand ULBP2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25600560 2015 CD74 expression and its therapeutic potential in thyroid carcinoma.
25304249 2014 CD74 interferes with the expression of fas receptor on the surface of lymphoma cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25175718 2015 MIF Receptor CD74 is Restricted to Microglia/Macrophages, Associated with a M1-Polarized Immune Milieu and Prolonged Patient Survival in Gliomas.
25172501 2014 Macrophage migration inhibitory factor triggers chemotaxis of CD74+CXCR2+ NKT cells in chemically induced IFN-?-mediated skin inflammation.
25035924 2014 Signal-peptide-peptidase-like 2a is required for CD74 intramembrane proteolysis in human B cells.
24939415 2014 Involvement of macrophage migration inhibitory factor and its receptor (CD74) in human breast cancer.
24731748 2014 High class II-associated invariant chain peptide expression on residual leukemic cells is associated with increased relapse risk in acute myeloid leukemia.
24683185 2014 HLA-DR?1 constructs block CD74 expression and MIF effects in experimental autoimmune encephalomyelitis.
24663824 2014 Involvement of CD74 in head and neck squamous cell carcinomas.
24638068 2014 The invariant chain p35 isoform promotes formation of nonameric complexes with MHC II molecules.
24594996 2014 CD74: a new prognostic factor for patients with malignant pleural mesothelioma.
24569872 2014 Migration inhibitory factor enhances inflammation via CD74 in cartilage end plates with Modic type 1 changes on MRI.
24469108 2014 CD74-NRG1 fusions in lung adenocarcinoma.
24220096 2014 Novel association between CD74 polymorphisms and hematologic toxicity in patients with NSCLC after platinum-based chemotherapy.
24205828 2014 Virus-encoded ectopic CD74 enhances poxvirus vaccine efficacy.
23730214 2013 CD74-dependent deregulation of the tumor suppressor scribble in human epithelial and breast cancer cells.
23572149 2013 High CD74 expression correlates with ZAP70 expression in B cell chronic lymphocytic leukemia patients.
23273913 2014 Down-regulation of CD74 inhibits growth and invasion in clear cell renal cell carcinoma through HIF-1? pathway.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23000905 2013 Reconsidering the diagnostic and prognostic utility of LN-2 for undifferentiated pleomorphic sarcoma and atypical fibroxanthoma.
22952837 2012 Macrophage migration inhibitory factor inhibits the migration of cartilage end plate-derived stem cells by reacting with CD74.
22942358 2012 Major histocompatibility complex class II+ invariant chain negative breast cancer cells present unique peptides that activate tumor-specific T cells from breast cancer patients.
22935920 2012 CD74: a potential novel target for triple-negative breast cancer.
22905972 2013 CD74 expression is increased in high-grade, invasive urothelial carcinoma of the bladder.
22889831 2012 Interaction of HLA-DR and CD74 at the cell surface of antigen-presenting cells by single particle image analysis.
22761382 2012 Hepatitis C virus-mediated inhibition of cathepsin S increases invariant-chain expression on hepatocyte surface.
22689013 2012 Human invariant chain isoform p35 restores thymic selection and antigen presentation in CD74-deficient mice.
22659450 2012 The oncogenic lung cancer fusion kinase CD74-ROS activates a novel invasiveness pathway through E-Syt1 phosphorylation.
22611320 2012 CD74 and macrophage migration inhibitory factor as therapeutic targets in gastric cancer.
22216005 2011 Epstein-Barr virus evades CD4+ T cell responses in lytic cycle through BZLF1-mediated downregulation of CD74 and the cooperation of vBcl-2.
22178447 2012 Stat1 and CD74 overexpression is co-dependent and linked to increased invasion and lymph node metastasis in triple-negative breast cancer.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22069105 2011 Increased risk of type 1 diabetes in Polish children - association with INS-IGF2 5'VNTR and lack of association with HLA haplotype.
22042694 2011 FTY720 increases CD74 expression and sensitizes mantle cell lymphoma cells to milatuzumab-mediated cell death.
22039051 2011 HIV-1 glycoprotein 41 ectodomain induces activation of the CD74 protein-mediated extracellular signal-regulated kinase/mitogen-activated protein kinase pathway to enhance viral infection.
21945129 2012 HIV-mediated up-regulation of invariant chain (CD74) correlates with generalized immune activation in HIV+ subjects.
21792010 2011 Expression of macrophage migration inhibitory factor and CD74 in cervical squamous cell carcinoma.
21748758 2012 Biological significance of perineural invasion (PNI) in prostate cancer.
21543057 2011 Invariant chain processing is independent of cathepsin variation between primary human B cells/dendritic cells and B-lymphoblastoid cells.
21423200 2011 Type I and II interferons enhance dendritic cell maturation and migration capacity by regulating CD38 and CD74 that have synergistic effects with TLR agonists.
21417823 2011 The secret second life of an innocent chaperone: the story of CD74 and B cell/chronic lymphocytic leukemia cell survival.
21269460 2011 Initial characterization of the human central proteome.
21228923 2010 Enhanced expression of CD74 in gastrointestinal cancers and benign tissues.
20864512 2010 A panel of sputum-based genomic marker for early detection of lung cancer.
20820776 2010 Alternative Ii-independent antigen-processing pathway in leukemic blasts involves TAP-dependent peptide loading of HLA class II complexes.
20646540 2010 [Expression of macrophage migration inhibitory factor and CD74 in preeclamptic placenta and its correlation with preeclampsia].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20443131 2010 Expression of CD74 in high grade gliomas: a potential role in temozolomide resistance.
20357260 2010 TAp63 regulates VLA-4 expression and chronic lymphocytic leukemia cell migration to the bone marrow in a CD74-dependent manner.
20198449 2010 Activation of CD74 inhibits migration of human mesenchymal stem cells.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19849849 2009 CD74 interacts with APP and suppresses the production of Abeta.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
19665027 2009 A functional heteromeric MIF receptor formed by CD74 and CXCR4.
19592662 2009 Diminished intracellular invariant chain expression after vaccinia virus infection.
19423618 2009 Increased CD74 expression in human atherosclerotic plaques: contribution to inflammatory responses in vascular cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19131591 2009 Expression of CD74, the receptor for macrophage migration inhibitory factor, in non-small cell lung cancer.
19092054 2009 MHC class II transport at a glance.
18941249 2008 Up-regulation of vascular endothelial growth factor-D expression in clear cell renal cell carcinoma by CD74: a critical role in cancer cell tumorigenesis.
18842989 2009 The MIF receptor CD74 in diabetic podocyte injury.
18828016 2009 Effect of invariant chain on major histocompatibility complex class I molecule expression and stability on human breast tumor cell lines.
18719072 2008 Identification of the invariant chain (CD74) as an angiotensin AGTR1-interacting protein.
18684948 2008 The MHC class II-associated invariant chain interacts with the neonatal Fc gamma receptor and modulates its trafficking to endosomal/lysosomal compartments.
18178838 2008 Regulation of CD1a surface expression and antigen presentation by invariant chain and lipid rafts.
17959659 2008 Human immunodeficiency virus type 1 Vpu protein interacts with CD74 and modulates major histocompatibility complex class II presentation.
17567581 2007 Structural and functional characterization of a secreted hookworm Macrophage Migration Inhibitory Factor (MIF) that interacts with the human MIF receptor CD74.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
17142775 2006 Inhibition of macrophage migration inhibitory factor or its receptor (CD74) attenuates growth and invasion of DU-145 prostate cancer cells.
17045821 2006 CD44 is the signaling component of the macrophage migration inhibitory factor-CD74 receptor complex.
16678175 2006 CLIP-region mediated interaction of Invariant chain with MHC class I molecules.
16618111 2006 Invariant chain transmembrane domain trimerization: a step in MHC class II assembly.
16542748 2006 Re-routing of the invariant chain to the direct sorting pathway by introduction of an AP3-binding motif from LIMP II.
16428763 2006 The Helicobacter pylori urease B subunit binds to CD74 on gastric epithelial cells and induces NF-kappaB activation and interleukin-8 production.
16242130 2005 Assembly of major histocompatibility complex class II subunits with invariant chain.
16107560 2005 CD74 is a member of the regulated intramembrane proteolysis-processed protein family.
15972644 2005 Helicobacter pylori-induced IL-8 production by gastric epithelial cells up-regulates CD74 expression.
15845476 2005 Helicobacter pylori binds to CD74 on gastric epithelial cells and stimulates interleukin-8 production.
15688398 2005 Tumor HLA-DR expression linked to early intrahepatic recurrence of hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475450 2004 CD74 is expressed by multiple myeloma and is a promising target for therapy.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12782713 2003 MIF signal transduction initiated by binding to CD74.
12661006 2003 Fusion of FIG to the receptor tyrosine kinase ROS in a glioblastoma with an interstitial del(6)(q21q21).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12058053 2002 The cytoplasmic tail of invariant chain regulates endosome fusion and morphology.
11927549 2002 Regulation of intracellular trafficking of human CD1d by association with MHC class II molecules.
11754812 2001 CD1d endosomal trafficking is independently regulated by an intrinsic CD1d-encoded tyrosine motif and by the invariant chain.
10981873 2000 Expression of MHC class II-associated invariant chain (Ii;CD74) in thymic epithelial neoplasms.
10748235 2000 Role for cathepsin F in invariant chain processing and major histocompatibility complex class II peptide loading by macrophages.
10022822 1999 Crystal structure of MHC class II-associated p41 Ii fragment bound to cathepsin L reveals the structural basis for differentiation between cathepsins L and S.
9843486 1998 Structure of a trimeric domain of the MHC class II-associated chaperonin and targeting protein Ii.
9752000 1998 An asymmetric deuterium labeling strategy to identify interprotomer and intraprotomer NOEs in oligomeric proteins.
8574855 1996 Association between HLA-DM and HLA-DR in vivo.
8397411 1993 Cell surface HLA-DR-invariant chain complexes are targeted to endosomes by rapid internalization.
8343954 1993 The chondroitin sulfate form of invariant chain can enhance stimulation of T cell responses through interaction with CD44.
8316295 1993 Three-dimensional structure of the human class II histocompatibility antigen HLA-DR1.
7519244 1994 Mapping functional regions in the lumenal domain of the class II-associated invariant chain.
7477400 1995 The structure of an intermediate in class II MHC maturation: CLIP bound to HLA-DR3.
6982931 1982 Biosynthesis and glycosylation of the invariant chain associated with HLA-DR antigens.
6955026 1982 Membrane insertion and oligomeric assembly of HLA-DR histocompatibility antigens.
6586420 1984 The complete sequence of the mRNA for the HLA-DR-associated invariant chain reveals a polypeptide with an unusual transmembrane polarity.
6576808 1983 Association of human gamma chain with class II transplantation antigens during intracellular transport.
6324166 1983 cDNA clone for the human invariant gamma chain of class II histocompatibility antigens and its implications for the protein structure.
3866610 1985 Ia-associated invariant chain is fatty acylated before addition of sialic acid.
3459184 1986 Structure of the human Ia-associated invariant (gamma)-chain gene: identification of 5' sequences shared with major histocompatibility complex class II genes.
3132422 1988 Localization of the HLA class II-associated invariant chain gene to human chromosome band 5q32.
3036998 1987 Four Ia invariant chain forms derive from a single gene by alternate splicing and alternate initiation of transcription/translation.
3001652 1985 Structure of the human gene encoding the invariant gamma-chain of class II histocompatibility antigens.
2507633 1989 The invariant chain is a phosphorylated subunit of class II molecules.
2391366 1990 Invariant chain trimers are sequestered in the rough endoplasmic reticulum in the absence of association with HLA class II antigens.
2121367 1990 MHC class II-associated invariant chain contains a sorting signal for endosomal compartments.
1448172 1992 HLA-DR molecules from an antigen-processing mutant cell line are associated with invariant chain peptides.