| Tchem | HLA class II histocompatibility antigen gamma chain |
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.
The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
Comments
| Disease | Target Count |
|---|---|
| Liver Failure, Acute | 22 |
| Mammary Neoplasms | 410 |
| non-small cell lung carcinoma | 413 |
CHEMBL377684
pIC50 6.01
CHEMBL204525
pIC50 6.02
CHEMBL207003
pIC50 6.03
CHEMBL377511
pIC50 6.05
CHEMBL206745
pIC50 6.09
CHEMBL408418
pIC50 6.13
CHEMBL201461
pIC50 6.39
| PMID | Text | |
|---|---|---|
| 27033518 | Studies indicate that the invariant chain (CD74) is critical for antigen presentation. | |
| 26500140 | FOXP1 represents a novel regulator of genes targeted by the class II MHC transactivator CIITA and CD74. | |
| 26412712 | an inverse correlation with the tumor size for stromal MIF and a positive correlation with the triple receptor negative tumor status for stromal CD74 seem to be showed | |
| 26198699 | Invariant chain is a new chaperone for TLR7 in B cells. (Review) | |
| 26039541 | Interferon gamma promotes melanoma cell survival regulating CD74-MIF interaction. | |
| 25998395 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 25983110 | A conserved WW domain-like motif regulates CD74 antigen-dependent cell-surface transport of the NKG2D ligand ULBP2. | |
| 25600560 | CD74 expression and its therapeutic potential in thyroid carcinoma | |
| 25304249 | Specific targeting of the CD74 on the lymphoma cell surface will sensitize CD74-expressing cancer cells to Fas-mediated apoptosis. | |
| 25175718 | The results of this stusy suggested that the CD74 represents a positive prognostic marker most probably because of its association with an M1-polarized immune milieu in high-grade gliomas. | |
| 25172501 | In TPA-induced skin inflammation, MIF is released from damaged keratinocytes and then triggers the chemotaxis of CD74(+)CXCR2(+) NKT cells for IFN-gamma production. | |
| 25035924 | In human B cells, SPPL2a is indispensable for turnover of CD74 N-terminal fragment. | |
| 24939415 | Findings showed an increased extent of MIF expression in cancer cells and in stromal fibroblasts of Breast Cancer tumor, in contrast to a less uniform increase of CD74 expression. | |
| 24904546 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 24731748 | demonstrate that CLIP expression on leukemia-associated phenotype (LAP)-positive cells during follow-up is significantly correlated with a shortened relapse-free survival | |
| 24683185 | These results demonstrate natural antagonist activity of DRalpha1 for macrophage migration inhibitory factor | |
| 24663824 | High CD74 expression is associated with head and neck squamous cell carcinomas. | |
| 24638068 | these results demonstrate that the subunit stoichiometry of oligomeric Ii/MHCII complexes is influenced by p35. | |
| 24594996 | High expression of CD74 is an independent prognostic factor for prolonged overall survival in mesothelioma patients | |
| 24569872 | MIF/CD74 pathway may represent a crucial target for treating disc degeneration since inhibiting the function of MIF with its antagonist ISO-1 can reduce MIF-induced inflammation and exert potent therapeutic effects. | |
| 24495362 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 24469108 | Results show that CD74-NRG1 gene fusions are activating genomic alterations in invasive mucinous lung adenocarcinomas. | |
| 24220096 | Polymorphisms in CD74 is associated with hematologic toxicity in patients with non-small-cell lung cancer after platinum-based chemotherapy. | |
| 24205828 | Recombinant vaccinia virus vaccines encoding CD74 may be useful tools to improve CD4 T-cell responses to viral and tumour antigens. | |
| 24035804 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 23730214 | when CD74 is overexpressed in human cancer and noncancerous epithelial cells, it interacts and interferes with the function of Scribble | |
| 23572149 | Evaluated expression of CD74 in chronic lymphocytic leukemia patients. CD74 expression was significantly higher in CLL group than in controls. There was positive correlation between CD74 and ZAP70 expression. | |
| 23289738 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 23273913 | Data show that clear cell renal cell carcinoma (ccRCC) tissue and malignant cell lines expressed higher levels of CD74 and hypoxia inducible factor 1alpha (HIF-1alpha) than adjacent normal renal tissue and normal cell HK-2. | |
| 23000905 | Our data do not replicate prior reports of LN-2 as a sensitive and specific marker for undifferentiated pleomorphic sarcoma | |
| 22952837 | a novel regulatory mechanism governing cell migration during intervertebral disc degeneration | |
| 22942358 | Ii regulates the repertoire of tumor peptides presented by major histocompatibility complex class II+ breast cancer cells. | |
| 22935920 | High Cd74 expression is associated with lymph node metastasis and triple-negative breast cancer. | |
| 22905972 | CD74 antigen expression is increased in high grade, invasive urothelial bladder cancer. | |
| 22889831 | Data indicate that 25 +/- 1.3% of CD74 and 17 +/- 0.3% of HLA-DR are colocalized. | |
| 22761382 | Hepatitis C virus-mediated inhibition of cathepsin S increases invariant-chain expression on hepatocyte surface. | |
| 22689013 | Data show that human Iip35 isoform (CD74 antigen) is expressed in mouse antigen presenting cells. | |
| 22659450 | Expression of CD74-ROS in noninvasive NSCLC cell lines readily conferred invasive properties that paralleled the acquisition of E-Syt1 phosphorylation. | |
| 22611320 | Upregulation of MIF, CD74 and TLR4 are associated with increasing clinical stage and provide an opportunity as novel gastric cancer chemoprevention and/or treatment strategy. | |
| 22216005 | Epstein-Barr virus evades CD4+ T cell responses in lytic cycle through BZLF1-mediated downregulation of CD74 and the cooperation of vBcl-2. | |
| 22178447 | Stat1 and CD74 overexpression is co-dependent and linked to increased invasion and lymph node metastasis in triple-negative breast cancer. | |
| 22069105 | Class I homozygosity at 5'VNTR is a significant risk factor of T1DM and acts independently from HLA haplotype in determining the actual risk of diabetes in children. | |
| 22042694 | Data show that FTY720-mediated disruption of the autophagic-lysosomal pathway led to increased levels of CD74, a potential therapeutic target in mantle cell lymphoma (MCL) that is degraded in the lysosomal compartment. | |
| 22039051 | HIV-1 glycoprotein 41 ectodomain induces activation of the CD74 protein-mediated extracellular signal-regulated kinase/mitogen-activated protein kinase pathway to enhance viral infection. | |
| 22039051 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 21945129 | This is the first study reporting that Ii chain up-regulation occurs on naturally infected antigen presenting cells obtained directly from HIV(+) subjects. | |
| 21922073 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 21792010 | overexpression of MIF and CD74 in cervical squamous cell carcinomas and its precancerous lesions and upregulation of VEGF secretion in cervical cancer cells indicate MIF and CD74 may play critical roles in pathogenesis and angiogenesis of cervical cancer | |
| 21748758 | These results suggest that cancer cells in the PNI areas could acquired a growth advantage that could be triggered by the growth factor receptors EGFR and CD74. | |
| 21543057 | CatG was found to be dispensable in invariant chain conversion within intact primary human B cells and dendritic cells. | |
| 21423200 | Synergistic TLR agonist stimulation in combination with IFN-alpha and IFN-gamma was the best method for regulating CD38 and CD74 expression | |
| 21417823 | Studies indicate that in chronic lymphocytic leukemia cells, binding of MIF to CD74 induces nuclear factor-kappaB activation and up-regulation of TAp63 expression, resulting in the secretion of interleukin 8, which in turn promotes cell survival. | |
| 21228923 | These findings are supportive of a role for CD74 in the development and maintenance of gastrointestinal neoplasia. | |
| 21068258 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 20864512 | Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator) | |
| 20820776 | Simultaneous inhibition of TAP and Ii completely down-modulated the expression of HLA-DR, demonstrating that together these molecules form the key mediators of HLA class II antigen presentation in leukemic blasts. | |
| 20646540 | Overexpression of MIF and CD74 in the placenta may up-regulate the CRP level in maternal blood, which may be involved in the pathogenesis of preeclampsia. | |
| 20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 20463068 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 20443131 | CD74 is expressed in a subset of high grade gliomas and may contribute to temozolomide resistance | |
| 20357260 | CD74 and its target gene transcripts (TA)p63 and very late antigen (VLA)-4 facilitate migration of chronic lymphocytic leukemia cells back to the bone marrow (BM), where they interact with the supportive BM environment that rescues them from apoptosis. | |
| 20198449 | CD74 activation inhibits in a dose-dependent manner up to 90% of in vitro migration of MSCs, with consistent effects observed among multiple MSC donor preparations. | |
| 20012522 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 19913121 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19845895 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19665027 | Data show that CD74 forms functional complexes with CXCR4 that mediate MIF-specific signaling. | |
| 19592662 | at late stages of Vaccinia virus infection, reductions in cellular invariant chain levels coupled with changes in lysosomal protease activity, contribute in part to defects in class II presentation | |
| 19423618 | CD74 levels are increased in plaques and PBMC from patients with carotid stenosis and are associated with intima-medial thickness in subjects free from clinical cardiovascular diseases. | |
| 19327048 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 19131591 | We found intense CD74 expression by immunohistochemistry in 57 of 70 human specimens of non-small cell lung cancer | |
| 18941249 | Increased expression of CD74 can enhance kidney cancer cell proliferation, anchorage independence, invasion, and tumor cell-induced human umbilical vein endothelial cell migration in vitro as well as tumor growth and metastasis in vivo. | |
| 18842989 | CD74 acts as a receptor for MIF in podocytes and may play a role in the pathogenesis of diabetic nephropathy | |
| 18828016 | Expression of Ii by breast tumor cells may quantitatively and qualitatively alter the presentation of antigens on those cells. | |
| 18719072 | The observations indicate that CD74 and the AGTR1 become associated in the early biosynthetic pathway, and that CD74 is a negative regulator of AGTR1 expression. | |
| 18684948 | This study provides several lines of evidence to demonstrate the complex interactions of major histocompatibility (MHC) class II invariant chain (Ii) with neonatal Fc receptor for IgG (FcRn). | |
| 18596106 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 18524831 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 18438604 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 18178838 | These findings identify Ii and lipid rafts as key regulators of CD1a organization on the surface of immature DCs and of its immunological function as Ag-presenting molecule | |
| 17959659 | The cytoplasmic region of Vpu was found to interact with the 30-amino-acid cytoplasmic tail of CD74. | |
| 17959659 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 17567581 | analysis of interaction between a secreted hookworm Macrophage Migration Inhibitory Factor (MIF) and the human MIF receptor CD74 | |
| 17142775 | Prostate cancer cell lines had increased MIF gene expression and protein levels; cell growth and invasion required MIF activated signal transduction pathways that were not necessary for growth or viability of androgen-dependent prostate cells | |
| 16678175 | Ii can also be detected in the class I MHC peptide loading complex. | |
| 16618111 | link the disruption of transmembrane helix interactions to previously reported losses of invariant chain function | |
| 16542748 | Residues favoring AP3 binding introduced into a protein that is transported via the PM such as the invariant chain can re-route such protein into direct sorting to late endosomal/lysosomal structures. | |
| 16454711 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 16439540 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 16428763 | H. pylori urease B binds to CD74 on gastric epithelial cells and initiates NF-kappaB activation and interleukin-8 production. | |
| 16365153 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 16107560 | We demonstrate that CD74-ICD translocates to the nucleus and induces the activation of the p65 member of NF-kappaB in this compartment. | |
| 15972644 | CD74 is expressed on the surface of gastric cells, and Helicobacter pylori can use this receptor as a point of attachment to gastric epithelial cells, which lead to IL-8 production. | |
| 15845476 | H.pylori binds to CD74 on gastric epithelial cells & stimulates interleukin-8 production; binding of H. pylori to CD74 presents a novel insight into an interaction of H. pylori with the gastric epithelium leading to upregulation of inflammatory responses | |
| 15688398 | Downregulation of HLA-DG is associated with early intrahepatic recurrence of hepatocellular carcinoma | |
| 15475450 | CD74 represents a novel and promising target for treatment of multiple myeloma. | |
| 15194762 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 12970439 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection | |
| 12782713 | MIF binds to the extracellular domain of CD74, and CD74 is required for MIF-induced activation of the extracellular signal-regulated kinase-1/2 MAP kinase cascade | |
| 12058053 | its cytoplasmic tail regulates endosome fusion and morphology | |
| 11897800 | Coordinate expression of Ii/CD74 and MHC class II antigens was identified in most fetal tissues | |
| 11593029 | HIV-1 Nef cloned from subjects with early/acute progressive HIV infection upregulates CD74 (Ii) in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection |
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYF 1 - 70 LYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTED 71 - 140 HVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVL 141 - 210 TKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDP 211 - 280 SSGLGVTKQDLGPVPM 281 - 296 //
| PMID | Year | Title | |
|---|---|---|---|
| 27033518 | 2016 | The multifaceted roles of the invariant chain CD74--More than just a chaperone. | |
| 26500140 | 2016 | FOXP1 suppresses immune response signatures and MHC class II expression in activated B-cell-like diffuse large B-cell lymphomas. | |
| 26412712 | 2015 | Macrophage migration inhibitory factor involvement in breast cancer (Review). | |
| 26198699 | 2015 | Invariant chain is a new chaperone for TLR7 in B cells. | |
| 26039541 | 2015 | Cell Surface CD74-MIF Interactions Drive Melanoma Survival in Response to Interferon-?. | |
| 25983110 | 2015 | A conserved WW domain-like motif regulates invariant chain-dependent cell-surface transport of the NKG2D ligand ULBP2. | |
| 25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. | |
| 25600560 | 2015 | CD74 expression and its therapeutic potential in thyroid carcinoma. | |
| 25304249 | 2014 | CD74 interferes with the expression of fas receptor on the surface of lymphoma cells. | |
| 25241761 | 2014 | Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network. | |
| 25175718 | 2015 | MIF Receptor CD74 is Restricted to Microglia/Macrophages, Associated with a M1-Polarized Immune Milieu and Prolonged Patient Survival in Gliomas. | |
| 25172501 | 2014 | Macrophage migration inhibitory factor triggers chemotaxis of CD74+CXCR2+ NKT cells in chemically induced IFN-?-mediated skin inflammation. | |
| 25035924 | 2014 | Signal-peptide-peptidase-like 2a is required for CD74 intramembrane proteolysis in human B cells. | |
| 24939415 | 2014 | Involvement of macrophage migration inhibitory factor and its receptor (CD74) in human breast cancer. | |
| 24731748 | 2014 | High class II-associated invariant chain peptide expression on residual leukemic cells is associated with increased relapse risk in acute myeloid leukemia. | |
| 24683185 | 2014 | HLA-DR?1 constructs block CD74 expression and MIF effects in experimental autoimmune encephalomyelitis. | |
| 24663824 | 2014 | Involvement of CD74 in head and neck squamous cell carcinomas. | |
| 24638068 | 2014 | The invariant chain p35 isoform promotes formation of nonameric complexes with MHC II molecules. | |
| 24594996 | 2014 | CD74: a new prognostic factor for patients with malignant pleural mesothelioma. | |
| 24569872 | 2014 | Migration inhibitory factor enhances inflammation via CD74 in cartilage end plates with Modic type 1 changes on MRI. | |
| 24469108 | 2014 | CD74-NRG1 fusions in lung adenocarcinoma. | |
| 24220096 | 2014 | Novel association between CD74 polymorphisms and hematologic toxicity in patients with NSCLC after platinum-based chemotherapy. | |
| 24205828 | 2014 | Virus-encoded ectopic CD74 enhances poxvirus vaccine efficacy. | |
| 23730214 | 2013 | CD74-dependent deregulation of the tumor suppressor scribble in human epithelial and breast cancer cells. | |
| 23572149 | 2013 | High CD74 expression correlates with ZAP70 expression in B cell chronic lymphocytic leukemia patients. | |
| 23273913 | 2014 | Down-regulation of CD74 inhibits growth and invasion in clear cell renal cell carcinoma through HIF-1? pathway. | |
| 23234360 | 2013 | LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins. | |
| 23000905 | 2013 | Reconsidering the diagnostic and prognostic utility of LN-2 for undifferentiated pleomorphic sarcoma and atypical fibroxanthoma. | |
| 22952837 | 2012 | Macrophage migration inhibitory factor inhibits the migration of cartilage end plate-derived stem cells by reacting with CD74. | |
| 22942358 | 2012 | Major histocompatibility complex class II+ invariant chain negative breast cancer cells present unique peptides that activate tumor-specific T cells from breast cancer patients. | |
| 22935920 | 2012 | CD74: a potential novel target for triple-negative breast cancer. | |
| 22905972 | 2013 | CD74 expression is increased in high-grade, invasive urothelial carcinoma of the bladder. | |
| 22889831 | 2012 | Interaction of HLA-DR and CD74 at the cell surface of antigen-presenting cells by single particle image analysis. | |
| 22761382 | 2012 | Hepatitis C virus-mediated inhibition of cathepsin S increases invariant-chain expression on hepatocyte surface. | |
| 22689013 | 2012 | Human invariant chain isoform p35 restores thymic selection and antigen presentation in CD74-deficient mice. | |
| 22659450 | 2012 | The oncogenic lung cancer fusion kinase CD74-ROS activates a novel invasiveness pathway through E-Syt1 phosphorylation. | |
| 22611320 | 2012 | CD74 and macrophage migration inhibitory factor as therapeutic targets in gastric cancer. | |
| 22216005 | 2011 | Epstein-Barr virus evades CD4+ T cell responses in lytic cycle through BZLF1-mediated downregulation of CD74 and the cooperation of vBcl-2. | |
| 22178447 | 2012 | Stat1 and CD74 overexpression is co-dependent and linked to increased invasion and lymph node metastasis in triple-negative breast cancer. | |
| 22171320 | 2012 | Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. | |
| 22069105 | 2011 | Increased risk of type 1 diabetes in Polish children - association with INS-IGF2 5'VNTR and lack of association with HLA haplotype. | |
| 22042694 | 2011 | FTY720 increases CD74 expression and sensitizes mantle cell lymphoma cells to milatuzumab-mediated cell death. | |
| 22039051 | 2011 | HIV-1 glycoprotein 41 ectodomain induces activation of the CD74 protein-mediated extracellular signal-regulated kinase/mitogen-activated protein kinase pathway to enhance viral infection. | |
| 21945129 | 2012 | HIV-mediated up-regulation of invariant chain (CD74) correlates with generalized immune activation in HIV+ subjects. | |
| 21792010 | 2011 | Expression of macrophage migration inhibitory factor and CD74 in cervical squamous cell carcinoma. | |
| 21748758 | 2012 | Biological significance of perineural invasion (PNI) in prostate cancer. | |
| 21543057 | 2011 | Invariant chain processing is independent of cathepsin variation between primary human B cells/dendritic cells and B-lymphoblastoid cells. | |
| 21423200 | 2011 | Type I and II interferons enhance dendritic cell maturation and migration capacity by regulating CD38 and CD74 that have synergistic effects with TLR agonists. | |
| 21417823 | 2011 | The secret second life of an innocent chaperone: the story of CD74 and B cell/chronic lymphocytic leukemia cell survival. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 21228923 | 2010 | Enhanced expression of CD74 in gastrointestinal cancers and benign tissues. | |
| 20864512 | 2010 | A panel of sputum-based genomic marker for early detection of lung cancer. | |
| 20820776 | 2010 | Alternative Ii-independent antigen-processing pathway in leukemic blasts involves TAP-dependent peptide loading of HLA class II complexes. | |
| 20646540 | 2010 | [Expression of macrophage migration inhibitory factor and CD74 in preeclamptic placenta and its correlation with preeclampsia]. | |
| 20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. | |
| 20458337 | MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis. | ||
| 20443131 | 2010 | Expression of CD74 in high grade gliomas: a potential role in temozolomide resistance. | |
| 20357260 | 2010 | TAp63 regulates VLA-4 expression and chronic lymphocytic leukemia cell migration to the bone marrow in a CD74-dependent manner. | |
| 20198449 | 2010 | Activation of CD74 inhibits migration of human mesenchymal stem cells. | |
| 19946888 | 2010 | Defining the membrane proteome of NK cells. | |
| 19913121 | 2009 | Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip. | |
| 19849849 | 2009 | CD74 interacts with APP and suppresses the production of Abeta. | |
| 19845895 | 2009 | Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations. | |
| 19665027 | 2009 | A functional heteromeric MIF receptor formed by CD74 and CXCR4. | |
| 19592662 | 2009 | Diminished intracellular invariant chain expression after vaccinia virus infection. | |
| 19423618 | 2009 | Increased CD74 expression in human atherosclerotic plaques: contribution to inflammatory responses in vascular cells. | |
| 19159218 | 2009 | Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. | |
| 19131591 | 2009 | Expression of CD74, the receptor for macrophage migration inhibitory factor, in non-small cell lung cancer. | |
| 19092054 | 2009 | MHC class II transport at a glance. | |
| 18941249 | 2008 | Up-regulation of vascular endothelial growth factor-D expression in clear cell renal cell carcinoma by CD74: a critical role in cancer cell tumorigenesis. | |
| 18842989 | 2009 | The MIF receptor CD74 in diabetic podocyte injury. | |
| 18828016 | 2009 | Effect of invariant chain on major histocompatibility complex class I molecule expression and stability on human breast tumor cell lines. | |
| 18719072 | 2008 | Identification of the invariant chain (CD74) as an angiotensin AGTR1-interacting protein. | |
| 18684948 | 2008 | The MHC class II-associated invariant chain interacts with the neonatal Fc gamma receptor and modulates its trafficking to endosomal/lysosomal compartments. | |
| 18178838 | 2008 | Regulation of CD1a surface expression and antigen presentation by invariant chain and lipid rafts. | |
| 17959659 | 2008 | Human immunodeficiency virus type 1 Vpu protein interacts with CD74 and modulates major histocompatibility complex class II presentation. | |
| 17567581 | 2007 | Structural and functional characterization of a secreted hookworm Macrophage Migration Inhibitory Factor (MIF) that interacts with the human MIF receptor CD74. | |
| 17192395 | 2007 | Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins. | |
| 17142775 | 2006 | Inhibition of macrophage migration inhibitory factor or its receptor (CD74) attenuates growth and invasion of DU-145 prostate cancer cells. | |
| 17045821 | 2006 | CD44 is the signaling component of the macrophage migration inhibitory factor-CD74 receptor complex. | |
| 16678175 | 2006 | CLIP-region mediated interaction of Invariant chain with MHC class I molecules. | |
| 16618111 | 2006 | Invariant chain transmembrane domain trimerization: a step in MHC class II assembly. | |
| 16542748 | 2006 | Re-routing of the invariant chain to the direct sorting pathway by introduction of an AP3-binding motif from LIMP II. | |
| 16428763 | 2006 | The Helicobacter pylori urease B subunit binds to CD74 on gastric epithelial cells and induces NF-kappaB activation and interleukin-8 production. | |
| 16242130 | 2005 | Assembly of major histocompatibility complex class II subunits with invariant chain. | |
| 16107560 | 2005 | CD74 is a member of the regulated intramembrane proteolysis-processed protein family. | |
| 15972644 | 2005 | Helicobacter pylori-induced IL-8 production by gastric epithelial cells up-regulates CD74 expression. | |
| 15845476 | 2005 | Helicobacter pylori binds to CD74 on gastric epithelial cells and stimulates interleukin-8 production. | |
| 15688398 | 2005 | Tumor HLA-DR expression linked to early intrahepatic recurrence of hepatocellular carcinoma. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15475450 | 2004 | CD74 is expressed by multiple myeloma and is a promising target for therapy. | |
| 15372022 | 2004 | The DNA sequence and comparative analysis of human chromosome 5. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12782713 | 2003 | MIF signal transduction initiated by binding to CD74. | |
| 12661006 | 2003 | Fusion of FIG to the receptor tyrosine kinase ROS in a glioblastoma with an interstitial del(6)(q21q21). | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12058053 | 2002 | The cytoplasmic tail of invariant chain regulates endosome fusion and morphology. | |
| 11927549 | 2002 | Regulation of intracellular trafficking of human CD1d by association with MHC class II molecules. | |
| 11754812 | 2001 | CD1d endosomal trafficking is independently regulated by an intrinsic CD1d-encoded tyrosine motif and by the invariant chain. | |
| 10981873 | 2000 | Expression of MHC class II-associated invariant chain (Ii;CD74) in thymic epithelial neoplasms. | |
| 10748235 | 2000 | Role for cathepsin F in invariant chain processing and major histocompatibility complex class II peptide loading by macrophages. | |
| 10022822 | 1999 | Crystal structure of MHC class II-associated p41 Ii fragment bound to cathepsin L reveals the structural basis for differentiation between cathepsins L and S. | |
| 9843486 | 1998 | Structure of a trimeric domain of the MHC class II-associated chaperonin and targeting protein Ii. | |
| 9752000 | 1998 | An asymmetric deuterium labeling strategy to identify interprotomer and intraprotomer NOEs in oligomeric proteins. | |
| 8574855 | 1996 | Association between HLA-DM and HLA-DR in vivo. | |
| 8397411 | 1993 | Cell surface HLA-DR-invariant chain complexes are targeted to endosomes by rapid internalization. | |
| 8343954 | 1993 | The chondroitin sulfate form of invariant chain can enhance stimulation of T cell responses through interaction with CD44. | |
| 8316295 | 1993 | Three-dimensional structure of the human class II histocompatibility antigen HLA-DR1. | |
| 7519244 | 1994 | Mapping functional regions in the lumenal domain of the class II-associated invariant chain. | |
| 7477400 | 1995 | The structure of an intermediate in class II MHC maturation: CLIP bound to HLA-DR3. | |
| 6982931 | 1982 | Biosynthesis and glycosylation of the invariant chain associated with HLA-DR antigens. | |
| 6955026 | 1982 | Membrane insertion and oligomeric assembly of HLA-DR histocompatibility antigens. | |
| 6586420 | 1984 | The complete sequence of the mRNA for the HLA-DR-associated invariant chain reveals a polypeptide with an unusual transmembrane polarity. | |
| 6576808 | 1983 | Association of human gamma chain with class II transplantation antigens during intracellular transport. | |
| 6324166 | 1983 | cDNA clone for the human invariant gamma chain of class II histocompatibility antigens and its implications for the protein structure. | |
| 3866610 | 1985 | Ia-associated invariant chain is fatty acylated before addition of sialic acid. | |
| 3459184 | 1986 | Structure of the human Ia-associated invariant (gamma)-chain gene: identification of 5' sequences shared with major histocompatibility complex class II genes. | |
| 3132422 | 1988 | Localization of the HLA class II-associated invariant chain gene to human chromosome band 5q32. | |
| 3036998 | 1987 | Four Ia invariant chain forms derive from a single gene by alternate splicing and alternate initiation of transcription/translation. | |
| 3001652 | 1985 | Structure of the human gene encoding the invariant gamma-chain of class II histocompatibility antigens. | |
| 2507633 | 1989 | The invariant chain is a phosphorylated subunit of class II molecules. | |
| 2391366 | 1990 | Invariant chain trimers are sequestered in the rough endoplasmic reticulum in the absence of association with HLA class II antigens. | |
| 2121367 | 1990 | MHC class II-associated invariant chain contains a sorting signal for endosomal compartments. | |
| 1448172 | 1992 | HLA-DR molecules from an antigen-processing mutant cell line are associated with invariant chain peptides. |
