Property Summary

NCBI Gene PubMed Count 29
PubMed Score 64.59
PubTator Score 57.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.835 3.3e-07
interstitial cystitis 2.400 8.9e-03
nasopharyngeal carcinoma -1.300 2.1e-03
invasive ductal carcinoma 1.300 2.6e-03
ulcerative colitis 1.300 4.4e-02
head and neck cancer and chronic obstruc... 1.200 2.1e-03

Protein-protein Interaction (4)

Gene RIF (17)

PMID Text
26883681 Increased soluble CD72 in systemic lupus erythematosus is in association with disease activity and lupus nephritis
24461079 CD72 expression on activated B cells of SLE patients was significantly lower than that of normal controls. sema3A enhanced CD72 expression of B cells, but it was still lower in SLE patients than in normal individuals.
23268649 regulates serum immunoglobulin leveln and disease resistance in systemic lupus erythematosus
23184497 data demonstrated aberrant expression of CD72 exists on B cells of myasthenia gravis and multiple sclerosis patients and expression level of CD72 molecule has a significantly negative correlation with anti-AchR antibody levels in myasthenia gravis
22606231 CD100, CD72 and CD45 were expressed in placenta and exhibited different mRNA and protein levels in normal pregnancy and miscarriage. Protein levels were highly dysregulated around 10 weeks of gestation in first and second miscarriage placentas.
22111667 CD72 mRNA expression level correlates with Sema4D expression in peripheral blood mononuclear cells in immune thrombocytopenia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20100931 Data show that ligation of CD72 with the BU40, or with rCD100 negatively regulates KIT-mediated mast cell proliferation, chemotaxis, and chemokine production.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18071878 CD72 polymorphisms are associated with age of appearing clinical manifestations in idiopathic thrombocytopenic purpura in Chinese patients.
18071878 Observational study of gene-disease association. (HuGE Navigator)
17786190 CD100-CD72 interaction can be the mechanism by which NK cell communicate with B cells.
17121583 increased nucleotide mutation of CD72 mRNA accounts for the decreased expression level of CD72 in B cells, and it might be related to hyperactivity of B cells in patients with SLE
16047337 CD72 is a key molecule in regulating mature B cell differentiation; CD72 signaling reduces the expression of X-box binding protein 1 in B cells
15459183 Observational study of gene-disease association. (HuGE Navigator)
15459183 results indicated that the presence of CD72-*2 allele decreases risk for human systemic lupus erythematosus conferred by FCGR2B-232Thr, possibly by increasing the AS isoform of CD72

AA Sequence

MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQP      1 - 70
TASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLR     71 - 140
QQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALE    141 - 210
QKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHS    211 - 280
YYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYIC    281 - 350
EMTAFRFPD                                                                 351 - 359
//

Text Mined References (29)

PMID Year Title
26883681 2016 Increased soluble CD72 in systemic lupus erythematosus is in association with disease activity and lupus nephritis.
24461079 2014 A regulatory role for CD72 expression on B cells in systemic lupus erythematosus.
23268649 2012 Human CD72 splicing isoform responsible for resistance to systemic lupus erythematosus regulates serum immunoglobulin level and is localized in endoplasmic reticulum.
23184497 2013 Modulation of B cell regulatory molecules CD22 and CD72 in myasthenia gravis and multiple sclerosis.
22606231 2012 Placental expression of CD100, CD72 and CD45 is dysregulated in human miscarriage.
22111667 2012 CD72 gene expression in immune thrombocytopenia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20100931 2010 CD72 negatively regulates KIT-mediated responses in human mast cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18071878 2008 CD72 polymorphism associated with child-onset of idiopathic thrombocytopenic purpura in Chinese patients.
17786190 2007 CD100 on NK cells enhance IFNgamma secretion and killing of target cells expressing CD72.
17121583 2006 Increased mutations of CD72 transcript in B-lymphocytes from adolescent patients with systemic lupus erythematosus.
16047337 2005 CD72-mediated suppression of human naive B cell differentiation by down-regulating X-box binding protein 1.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459183 2004 CD72 polymorphisms associated with alternative splicing modify susceptibility to human systemic lupus erythematosus through epistatic interaction with FCGR2B.
12882840 2003 Involvement of CD100, a lymphocyte semaphorin, in the activation of the human immune system via CD72: implications for the regulation of immune and inflammatory responses.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11466342 2001 Positive signaling through CD72 induces mitogen-activated protein kinase activation and synergizes with B cell receptor signals to induce X-linked immunodeficiency B cell proliferation.
11114375 2000 Identification of CD72 as a lymphocyte receptor for the class IV semaphorin CD100: a novel mechanism for regulating B cell signaling.
10820378 2000 BLNK is associated with the CD72/SHP-1/Grb2 complex in the WEHI231 cell line after membrane IgM cross-linking.
9740800 1998 The B-cell transmembrane protein CD72 binds to and is an in vivo substrate of the protein tyrosine phosphatase SHP-1.
9590210 1998 The B cell surface protein CD72 recruits the tyrosine phosphatase SHP-1 upon tyrosine phosphorylation.
9110174 1997 Large-scale concatenation cDNA sequencing.
8806810 1996 Native soluble CD5 delivers a costimulatory signal to resting human B lymphocytes.
2141045 1990 Identification of a human protein homologous to the mouse Lyb-2 B cell differentiation antigen and sequence of the corresponding cDNA.
2044654 1991 Identity of human Lyb-2 and CD72 and localization of the gene to chromosome 9.
1711157 1991 The B-cell surface protein CD72/Lyb-2 is the ligand for CD5.