Property Summary

NCBI Gene PubMed Count 40
PubMed Score 783.52
PubTator Score 532.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.627 3.5e-06
tuberculosis and treatment for 6 months -1.300 5.2e-05
active Crohn's disease -1.020 4.0e-02
psoriasis 2.000 2.3e-46

 GO Function (1)

Gene RIF (21)

PMID Text
25679063 in acute myeloid leukemia patients the association of CD7 positivity and FLT3 positivity was found to be significant
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD7
24920488 Data show that CD7 promotes extramedullary involvement of the B-ALL line Tanoue in an integrin beta2-dependent manner.
24727323 We showed that the CADM1 versus CD7 plot is capable of discriminating clonally expanding HTLV-I-infected cells in indolent and acute-type T-cell leukemia-lymphomas and in asymptomatic carriers
24211252 SECTM1 secreted from bone marrow stromal cells may interact with CD7 to influence GM-CSF expression in leukemic cells.
24157461 CD7 is present on monocytes and tumor macrophages and its ligand, SECTM1, is frequently expressed in corresponding melanoma tissues
20398252 epigenetic down-regulation of CD7 is associated with acute myeloid leukemia.
20175919 These findings indicate a link between epigenetic modifications and CD7 expression in primitive chronic myeloid leukemia cells.
20046078 CD7 loss in aggressive natural killer-cell leukemia; a useful diagnostic marker
19937140 low expression in T-cell lymphomas due to Twist2-mediated suppression of promoter activity; enhanced by histone deacetylase inhibitors
19683346 the galectin-1 glycoprotein receptor CD7 maybe a novel target for GdA on T cells.
19207946 by down-regulating CD7, ATLL cells could have escaped Gal-3-induced apoptosis to run a more aggressive clinical course
18956470 The CD7 expression in CD4(+) T cells discriminates between HL and reactive LAD, suggesting that this could be a useful and practical adjunctive tool in the diagnosis of Hodgkin lymphoma.
18343790 close association of aberrant CD7 expression and FLT3/ITD mutation in the myeloblasts of FLT3/ITD+ acute myeloid leukemia suggests that FLT3/ITD- mediated leukemic transformation occurs in the more early stage of myeloid progenitor cells
17959857 differential levels of CD7 identify the progressive stages of lineage commitment in human thymus, initiated from a primitive CD7(-) lympho-myeloid thymic progenitor
17287851 HTLV-IInfected cells acquired a profound decrease of intracellular calcium levels in response to ionomycin, timely correlated with decreased CD7 expression
16990185 CD7 antigen notably expresses in lung microvascular endothelial cells (LME) and that it acts as an Fc receptor for IgM in LME cells.
16837044 Patients expressing CD7 had significant shorter disease free (DFS) and post-remission survivals (PRS) than patients without CD7 (DFS of 12 months versus 42 months, P=0.005; PRS of 15 months versus 33 months, P=0.013).
16332967 a novel fusion protein, designated scFvCD7:sFasL is designed to have leukemia-restricted activity.
12594831 Association of T cell antigen CD7 with type II phosphatidylinositol-4 kinase, a key component in pathways of inositol phosphate turnover.
12393702 CD7 expression in hematopoitic cells denotes commitment to B-cell and natural killer cells lineages.

AA Sequence

MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDII      1 - 70
YYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWH     71 - 140
RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCS    141 - 210
WRDKNSAACVVYEDMSHSRCNTLSSPNQYQ                                            211 - 240
//

Text Mined References (43)

PMID Year Title
25679063 2015 Correlation of FLT3 mutations with expression of CD7 in acute myeloid leukemia.
24920488 2014 CD7 promotes extramedullary involvement of the B-cell acute lymphoblastic leukemia line Tanoue by enhancing integrin ?2-dependent cell adhesiveness.
24727323 2014 CADM1 expression and stepwise downregulation of CD7 are closely associated with clonal expansion of HTLV-I-infected cells in adult T-cell leukemia/lymphoma.
24211252 2014 Autocrine GM-CSF transcription in the leukemic progenitor cell line KG1a is mediated by the transcription factor ETS1 and is negatively regulated through SECTM1 mediated ligation of CD7.
24157461 2014 SECTM1 produced by tumor cells attracts human monocytes via CD7-mediated activation of the PI3K pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20398252 2010 CD7 in acute myeloid leukemia: correlation with loss of wild-type CEBPA, consequence of epigenetic regulation.
20175919 2010 Expression of the leukemic prognostic marker CD7 is linked to epigenetic modifications in chronic myeloid leukemia.
20046078 2009 Frequent CD7 antigen loss in aggressive natural killer-cell leukemia: a useful diagnostic marker.
19937140 2009 Twist2 regulates CD7 expression and galectin-1-induced apoptosis in mature T-cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19683346 2009 Glycodelin A triggers T cell apoptosis through a novel calcium-independent galactose-binding lectin activity.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19207946 2009 Loss of CD7, independent of galectin-3 expression, implies a worse prognosis in adult T-cell leukaemia/lymphoma.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18956470 2009 Overexpression of CD7 in classical Hodgkin lymphoma-infiltrating T lymphocytes.
18343790 2008 Aberrant expression of CD7 in myeloblasts is highly associated with de novo acute myeloid leukemias with FLT3/ITD mutation.
17959857 2008 Human intrathymic lineage commitment is marked by differential CD7 expression: identification of CD7- lympho-myeloid thymic progenitors.
17287851 2007 HTLV-I infection of WE17/10 CD4+ cell line leads to progressive alteration of Ca2+ influx that eventually results in loss of CD7 expression and activation of an antiapoptotic pathway involving AKT and BAD which paves the way for malignant transformation.
16990185 Role of CD7 expressed in lung microvascular endothelial cells as Fc receptor for immunoglobulin M.
16837044 2007 CD7 expression predicts poor disease free survival and post-remission survival in patients with acute myeloid leukemia and normal karyotype.
16332967 2006 CD7-restricted activation of Fas-mediated apoptosis: a novel therapeutic approach for acute T-cell leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12594831 2003 Association of T cell antigen CD7 with type II phosphatidylinositol-4 kinase, a key component in pathways of inositol phosphate turnover.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393702 2003 B lymphopoiesis is active throughout human life, but there are developmental age-related changes.
11485208 2001 T cell signal transduction and the role of CD7 in costimulation.
11423532 2001 Association of insulin-like growth factor 1 receptor with EHD1 and SNAP29.
10652336 2000 Identification of CD7 as a cognate of the human K12 (SECTM1) protein.
10490978 1999 Restricted receptor segregation into membrane microdomains occurs on human T cells during apoptosis induced by galectin-1.
9852078 1998 Three novel proteins of the syntaxin/SNAP-25 family.
9480746 1998 Identification and characterization of K12 (SECTM1), a novel human gene that encodes a Golgi-associated protein with transmembrane and secreted isoforms.
8918688 1996 Functional association of CD7 with phosphatidylinositol 3-kinase: interaction via a YEDM motif.
8871597 1996 Interaction between the extracellular domain of CD7 and concanavalin A: a clue to the identity of the ligand for CD7.
8666891 1996 Major histocompatibility complex class II-associated p41 invariant chain fragment is a strong inhibitor of lysosomal cathepsin L.
8662072 1996 The mouse CD7 gene: identification of a new element common to the human CD7 and mouse Thy-1 promoters.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
3501369 1987 Molecular cloning of two CD7 (T-cell leukemia antigen) cDNAs by a COS cell expression system.
3258561 1988 Assignment of a gene coding for a human T-cell antigen with a molecular weight of 40,000 daltons to chromosome 17.
2479685 1989 Characterization of the surface topography and putative tertiary structure of the human CD7 molecule.
1711009 1991 Molecular cloning of the gene coding for the human T cell differentiation antigen CD7.
1703303 1991 Isolation and characterization of the genomic human CD7 gene: structural similarity with the murine Thy-1 gene.
1695199 1990 Localization of the cell surface antigen CD7 by chromosomal in situ hybridization.