Property Summary

NCBI Gene PubMed Count 68
PubMed Score 3485.90
PubTator Score 2234.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Spontaneous abortion 113

Expression

Protein-protein Interaction (9)

Gene RIF (56)

AA Sequence

MRLAVLFSGALLGLLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTT      1 - 70
SHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHP     71 - 140
EPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGA    141 - 210
HPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNS    211 - 280
SIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCIIRRRPSA    281 - 350
YQAL                                                                      351 - 354
//

Text Mined References (75)

PMID Year Title