Property Summary

NCBI Gene PubMed Count 116
PubMed Score 665.00
PubTator Score 565.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.600 6.9e-04
ependymoma 1.200 1.5e-14
atypical teratoid / rhabdoid tumor 1.200 2.9e-06
diabetes mellitus -1.300 5.6e-03
pediatric high grade glioma 1.500 2.0e-08
pilocytic astrocytoma 1.400 1.5e-10
subependymal giant cell astrocytoma 1.873 1.5e-03
mucosa-associated lymphoid tissue lympho... 1.338 2.8e-02
ovarian cancer 1.700 1.9e-04

Gene RIF (124)

PMID Text
26242181 CD163(+) TAMs in oral premalignant lesions coexpress CD163 and STAT1, suggesting that the TAMs in oral premalignant lesions possess an M1 phenotype in a Th1-dominated micromilieu.
26213230 These findings indicate that rhTIMP-1 promotes clonogenic expansion and survival in human progenitors via the activation of the CD63/PI3K/pAkt signaling pathway
26109641 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
26001794 Our findings reveal that elevated levels of TIMP-1 impact on neutrophil homeostasis via signaling through CD63.
25973004 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25973004 siRNA knockdown of CD63 in U1/HIV-1 cells (chronically infected monocytoid cells harboring 2 integrated copies of HIV provirus per cell) decreases CA (p24) levels in supernatants but does not affect intracellular CA (p24) levels
25940347 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25870000 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25760631 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25658293 It was shown that treatment of macrophages with anti-CD63 inhibits CCR5-mediated virus infection in a cell type-specific manner, but that no inhibition of CXCR4-tropic viruses occurs.
25354204 Data show that CD63 is a crucial player in the regulation of the tumor cell-intrinsic metastatic potential by affecting cell plasticity.
25297946 Diesel exhaust exposure during exercise induces platelet activation as illustrated by a dose-response increase in the release of CD62P and CD63.
25275127 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25184547 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25118280 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25056899 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25033048 TM4SF5 interacted with CD151, and caused the internalization of CD63 from the cell surface.
25009540 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
24940653 CD63 tetraspanin is a negative driver of epithelial-to-mesenchymal transition in human melanoma cells.
24884960 these results indicated that high glycosylation of CD63 by RPN2 is implicated in clinical outcomes in breast cancer patients
24872578 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
24635319 Data suggest that TIMP1 (tissue inhibitor of metalloproteinase-1) acts as chemoattractant for neural stem cells (NSC); TIMP1 enhances NSC adhesion, migration, and cytoskeletal reorganization; these effects are dependent on CD63/CD29 (integrin beta1).
24608085 CD9 and CD63 tetraspanins block HIV-1-induced cell-cell fusion at the transition from hemifusion to pore opening.
24608085 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
24507450 Collectively, these findings indicate that CD63 may support Env-mediated fusion as well as a late (post-integration) step in the HIV-1 replication cycle.
24507450 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
24507450 siRNA knockdown of CD63 in U1/HIV-1 cells (chronically infected monocytoid cells harboring 2 integrated copies of HIV provirus per cell) decreases CA (p24) levels in supernatants but does not affect intracellular CA (p24) levels
24489825 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
23522389 Timp1 is assembled in a supramolecular complex containing CD63 and beta1-integrins along melanoma genesis and confers anoikis resistance by activating PI3-K signaling pathway.
23072732 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
22980332 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
22875976 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
22830021 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
22808325 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21909273 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21803846 Loss of CD63 has a similar phenotype to loss of P-selectin itself, thus CD63 is an essential cofactor to P-selectin.
21660937 shRNA knockdown in B lymphoblastoid cell line results to increased CD4(+) T-cell recognition
21527913 C-terminal modifications that retain LMP1 in Golgi compartments preclude assembly within CD63-enriched domains and/or exosomal discharge leading to NF-kappaB overstimulation.
21521534 decreased levels of CD63 were associated with distant and lymph node metastasis status and does play a direct role in human gastric carcinogenesis.
21315401 These findings suggest that CD63 plays an early post-entry role prior to or at the reverse transcription step.
21315401 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21315401 siRNA knockdown of CD63 in U1/HIV-1 cells (chronically infected monocytoid cells harboring 2 integrated copies of HIV provirus per cell) decreases CA (p24) levels in supernatants but does not affect intracellular CA (p24) levels
21248205 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21149578 ameloblastin is expressed in osteoblasts and functions as a promoting factor for osteogenic differentiation via a novel pathway through the interaction between CD63 and integrin beta1
20727121 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
20693981 this work provides the first evidence of a TIMP-4/CD63 association in astrocytoma tumor cells
20633031 CD63 expression results from only the anaphylactic degranulation form of histamine release.
20622010 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
20337613 Surface expression of the novel CD63 variant is a distinguishing feature of mast cells, which are are stable, multiple-use cells capable of surviving and delivering several consecutive hits
20237496 Observational study of gene-disease association. (HuGE Navigator)
20012524 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19912576 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19894777 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19802344 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19602278 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19581020 Serum sCD163 is a homogenous protein covering more than 94% of the CD163 ectodomain including the haptoglobin-hemoglobin -binding region.
19474101 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19458002 CD9, CD81 and CD63 are negative regulators of HIV-1-induced cell-cell fusion.
19458002 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19426143 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19403684 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19381331 Exotest for CD63+ plasma exosomes had limited sensitivity but the Exotest for detection of caveolin-1+ plasma exosomes showed a higher sensitivity. Caveolin-1+ plasma exosomes were significantly increased with respect to CD63+ exosomes in patients group
19369333 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19297499 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19284574 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19079288 the activation-induced degranulation of Fas ligand has distinct requirements and involves different mechanisms than those of the granule markers CD63 and CD107a/Lamp-1
18977142 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18946087 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18727065 Antigen-induced p38 MAPK phosphorylation in human basophils essentially contributes to CD63 upregulation
18714047 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18682304 siRNA knockdown of CD63 in U1/HIV-1 cells (chronically infected monocytoid cells harboring 2 integrated copies of HIV provirus per cell) decreases CA (p24) levels in supernatants but does not affect intracellular CA (p24) levels
18669870 CD63 is involved in granule targeting of neutrophil elastase
18600034 Induction of hypercortisolism in healthy volunteers was associated with a trend toward higher expression of glycoprotein 53 on the platelet surface.
18500329 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18426873 These studies confirm CD63 as a constituent in multivesicular body-to-chlamydial inclusion transport but it is not required for this association.
18369466 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18321974 Together, our results indicate that at least in tissue culture, CD63 expression is not required for either the production or the infectivity of HIV-1.
18321974 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18305041 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18211905 CD63 plays a role in the regulation of ROMK channels through its association with RPTPalpha, which in turn interacts with and activates Src family PTK, thus reducing ROMK activity.
18182005 Data show that an N-terminal deletion mutant of CD63 blocks entry of CXCR4-using, T-cell tropic human immunodeficiency virus type 1 (X4 HIV-1) by suppressing CXCR4 surface expression.
18076669 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18059278 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
18006034 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
17989173 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
17827389 PrP(c) at the cell surface of cultured human erythroblasts is rapidly internalized through the endosomal pathway, where it colocalizes with the tetraspanin CD63.
17624082 There is low expression of the proteins and mRNA of ME491/CD63 and integrin alpha5 in ovarian cancer. The lower the pathological differentiation is, the more significant the loss of expression is and the more likely metastasis is.
17550307 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
17522207 Data show that HIV-1 envelope glycoprotein (Env) and core protein (Gag) colocalize strongly with CD63 and CD81 and less strongly with CD9, and suggest that HIV-1 promotes virus assembly and cell-cell transfer by targeting these plasma membrane proteins.
17522207 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
17390088 These results suggest that chronic obstructive pulmonary disease patients have different patterns of CD63 expression and polymorphonuclear neutrophils mediator release than healthy individuals.
17381240 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
17350713 Results suggest that CD63 can be a biomarker for predicting the prognosis in early stages of lung adenocarcinoma.
17279322 positive correlation between CD63 and erythrocyte sedimentation rate in rheumatoid arthritis
17275019 In conclusion, using well-defined experimental conditions, the measurement of CD203c up-regulation on basophils in response to specific allergens is as reliable as CD63-BAT for the in vitro diagnosis of patients with IgE-mediated allergy.
16940516 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
16918509 Chronic urticaria serum-induced CD63 expression assay performed on atopic whole blood by means of tricolor flow cytometry could be the most useful tool for identification of a subset of patients with autoimmune chronic urticaria.
16917503 CD63 is a cell surface binding partner for TIMP-1, regulating cell survival and polarization via TIMP-1 modulation of tetraspanin/integrin signaling complex.
16908530 CD63-syntenin-1 complex is abundant on the plasma membrane
16735575 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
16683918 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
16683915 CD63 is recruited to already-budded Weibel-Palade bodies by an AP-3-dependent route
16682056 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
16533950 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
16410552 This study identifies a trafficking pathway from CD63-positive multivesicular bodies to the bacterial inclusion, a novel interaction that provides essential lipids necessary for maintenance of a productive intracellular infection.
15711748 The linkage of CD63 with PI 4-kinase may result in the recruitment of this signaling enzyme to specific membrane locations in the platelet where it influences phosphoinositide-dependent signaling and platelet spreading.
15528334 CD63 represents an activation-induced reinforcing element, whose triggering promotes sustained and efficient T cell activation and expansion.
15375577 Constitutive expression of CD63 may indicate that this factor does not play a direct role in thyroid carcinogenesis
15140999 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
15130945 results suggest that CD9, CD63, CD81, and CD82 could play a role in modulating the interactions between immature DCs and their environment, slowing their migratory ability. However, only CD63 would intervene in the internalization of complex antigens
14722309 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
14660791 CD63 serves as an adaptor protein that links its interaction partners to the endocytic machinery of the cell.
12974720 The study on CD63 included its chemistry eg. if it had and O-linked carbohydrate that was digested with O-glycanase.
12885763 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
12871315 Upon platelet interaction with fibrinogen, cholesterol accumulated at the tips of filopodia and at the leading edge of spreading cells; cholesterol-rich raft aggregation was accompanied by concentration of c-Src and CD63 in these cell domains
12826159 relationships between the expression levels of CD61, CD63, and PAC-1 on the platelet surface and the incidences of acute rejection and tubular necrosis as well as the recovery of graft function after renal transplantation
12755696 Post-translational modification of CD63 may be involved in the functional and morphological changes of MHC class II compartments that occur during dendritic cell maturation
12610138 possible role in HIV-1 infections specific for macrophages
12579280 downregulation of CD63 antigen is associated with breast tumor progression
12230470 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
12036870 C-kit is physically associated with transmembrane 4 superfamily proteins CD9, CD63, and CD81, that may negatively modulate c-kit and thus regulate c-kit receptor sensitivity to SLF in hematopoietic progenitors.
11907283 Results show that AP-3 is absolutely required for the delivery of CD63 to lysosomes via the trans-Golgi network.
11584299 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
9685355 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP

AA Sequence

MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFV      1 - 70
GCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQ     71 - 140
ADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAA    141 - 210
LGIAFVEVLGIVFACCLVKSIRSGYEVM                                              211 - 238
//

Text Mined References (124)

PMID Year Title
27114500 2016 Exosomes surf on filopodia to enter cells at endocytic hot spots, traffic within endosomes, and are targeted to the ER.
26242181 2015 Tumor-associated macrophages in oral premalignant lesions coexpress CD163 and STAT1 in a Th1-dominated microenvironment.
26213230 2015 The tissue inhibitor of metalloproteinases 1 increases the clonogenic efficiency of human hematopoietic progenitor cells through CD63/PI3K/Akt signaling.
26001794 2015 TIMP-1 signaling via CD63 triggers granulopoiesis and neutrophilia in mice.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25658293 2015 In Sweet Harmony: CD63 and HIV-1.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25354204 2015 Tetraspanin CD63 acts as a pro-metastatic factor via ?-catenin stabilization.
25312088 2014 Investigation of membrane protein-protein interactions using correlative FRET-PLA.
25297946 2015 Pro-thrombotic effect of exercise in a polluted environment: a P-selectin- and CD63-related platelet activation effect.
25033048 2014 Correlations between transmembrane 4 L6 family member 5 (TM4SF5), CD151, and CD63 in liver fibrotic phenotypes and hepatic migration and invasive capacities.
24940653 2014 CD63 tetraspanin is a negative driver of epithelial-to-mesenchymal transition in human melanoma cells.
24884960 2014 RPN2-mediated glycosylation of tetraspanin CD63 regulates breast cancer cell malignancy.
24635319 2014 TIMP-1 modulates chemotaxis of human neural stem cells through CD63 and integrin signalling.
24608085 2014 Evidence showing that tetraspanins inhibit HIV-1-induced cell-cell fusion at a post-hemifusion stage.
24507450 2014 The dual role of tetraspanin CD63 in HIV-1 replication.
23632027 2013 Tetraspanin CD63 promotes vascular endothelial growth factor receptor 2-?1 integrin complex formation, thereby regulating activation and downstream signaling in endothelial cells in vitro and in vivo.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23522389 2013 Timp1 interacts with beta-1 integrin and CD63 along melanoma genesis and confers anoikis resistance by activating PI3-K signaling pathway independently of Akt phosphorylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23092844 2013 Monitoring the Rab27 associated exosome pathway using nanoparticle tracking analysis.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22431521 2012 The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting.
21962903 2011 The tetraspanin CD63 regulates ESCRT-independent and -dependent endosomal sorting during melanogenesis.
21803846 2011 CD63 is an essential cofactor to leukocyte recruitment by endothelial P-selectin.
21660937 2011 The role of tetraspanin CD63 in antigen presentation via MHC class II.
21527913 2011 LMP1 association with CD63 in endosomes and secretion via exosomes limits constitutive NF-?B activation.
21521534 2011 Down-regulation of TM4SF is associated with the metastatic potential of gastric carcinoma TM4SF members in gastric carcinoma.
21505438 2011 Unidirectional transfer of microRNA-loaded exosomes from T cells to antigen-presenting cells.
21315401 2011 A post-entry role for CD63 in early HIV-1 replication.
21269460 2011 Initial characterization of the human central proteome.
21149578 2011 Ameloblastin regulates osteogenic differentiation by inhibiting Src kinase via cross talk between integrin beta1 and CD63.
20693981 2010 TIMP-4 and CD63: new prognostic biomarkers in human astrocytomas.
20633031 2010 Expression of CD203c and CD63 in human basophils: relationship to differential regulation of piecemeal and anaphylactic degranulation processes.
20337613 2010 A granular variant of CD63 is a regulator of repeated human mast cell degranulation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19640571 2010 Palmitoylation supports the association of tetraspanin CD63 with CD9 and integrin alphaIIbbeta3 in activated platelets.
19581020 2010 Soluble macrophage-derived CD163: a homogenous ectodomain protein with a dissociable haptoglobin-hemoglobin binding.
19458002 2009 Formation of syncytia is repressed by tetraspanins in human immunodeficiency virus type 1-producing cells.
19381331 2009 High levels of exosomes expressing CD63 and caveolin-1 in plasma of melanoma patients.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19079288 2009 Distinct requirements for activation-induced cell surface expression of preformed Fas/CD95 ligand and cytolytic granule markers in T cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18727065 2009 Simultaneous flow cytometric detection of basophil activation marker CD63 and intracellular phosphorylated p38 mitogen-activated protein kinase in birch pollen allergy.
18669870 2008 The tetraspanin CD63 is involved in granule targeting of neutrophil elastase.
18600034 2008 How depression may increase cardiac risk: effect of hypercortisolism on platelet activation markers: preliminary data.
18426873 2008 Late endocytic multivesicular bodies intersect the chlamydial inclusion in the absence of CD63.
18321974 2008 CD63 is not required for production of infectious human immunodeficiency virus type 1 in human macrophages.
18211905 2008 Expression of tetraspan protein CD63 activates protein-tyrosine kinase (PTK) and enhances the PTK-induced inhibition of ROMK channels.
18182005 2008 A CD63 mutant inhibits T-cell tropic human immunodeficiency virus type 1 entry by disrupting CXCR4 trafficking to the plasma membrane.
17897319 2007 Integral and associated lysosomal membrane proteins.
17827389 2007 Normal prion protein trafficking in cultured human erythroblasts.
17624082 2007 Expression and significance of the protein and mRNA of metastasis suppressor gene ME491/CD63 and integrin alpha5 in ovarian cancer tissues.
17522207 2007 Human immunodeficiency virus type 1 assembly, budding, and cell-cell spread in T cells take place in tetraspanin-enriched plasma membrane domains.
17390088 2007 PMN degranulation in relation to CD63 expression and genetic polymorphisms in healthy individuals and COPD patients.
17350713 2007 CD63 as a biomarker for predicting the clinical outcomes in adenocarcinoma of lung.
17279322 2007 The significance of platelet activation in rheumatoid arthritis.
17275019 2007 Flow cytometry for basophil activation markers: the measurement of CD203c up-regulation is as reliable as CD63 expression in the diagnosis of cat allergy.
16918509 2006 Serum-induced basophil CD63 expression by means of a tricolour flow cytometric method for the in vitro diagnosis of chronic urticaria.
16917503 2006 Identification of CD63 as a tissue inhibitor of metalloproteinase-1 interacting cell surface protein.
16908530 2006 Syntenin-1 is a new component of tetraspanin-enriched microdomains: mechanisms and consequences of the interaction of syntenin-1 with CD63.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16683915 2006 P-selectin and CD63 use different mechanisms for delivery to Weibel-Palade bodies.
16541075 2006 The finished DNA sequence of human chromosome 12.
16410552 2006 Trafficking from CD63-positive late endocytic multivesicular bodies is essential for intracellular development of Chlamydia trachomatis.
15908444 2005 Exosomal-like vesicles are present in human blood plasma.
15711748 2005 CD63 modulates spreading and tyrosine phosphorylation of platelets on immobilized fibrinogen.
15647390 2005 CD63 interacts with the carboxy terminus of the colonic H+-K+-ATPase to decrease [corrected] plasma membrane localization and 86Rb+ uptake.
15528334 2004 CD63 as an activation-linked T cell costimulatory element.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375577 2004 CD82, and CD63 in thyroid cancer.
15351990 2004 LAMP-1 and LAMP-2, but not LAMP-3, are reliable markers for activation-induced secretion of human mast cells.
15229288 2004 Over-expression of Rififylin, a new RING finger and FYVE-like domain-containing protein, inhibits recycling from the endocytic recycling compartment.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15130945 2004 CD63 tetraspanin slows down cell migration and translocates to the endosomal-lysosomal-MIICs route after extracellular stimuli in human immature dendritic cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660791 2003 The tetraspanin CD63 enhances the internalization of the H,K-ATPase beta-subunit.
12974720 2003 Characterisation of the biosynthesis and processing of the neutrophil granule membrane protein CD63 in myeloid cells.
12871315 2003 Concentration of rafts in platelet filopodia correlates with recruitment of c-Src and CD63 to these domains.
12826159 2003 Relationship between the expression levels of CD61, CD63, and PAC-1 on platelet surface in peripheral blood and the transplanted kidney function.
12755696 2003 Differential post-translational modification of CD63 molecules during maturation of human dendritic cells.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12610138 2003 Potential role for CD63 in CCR5-mediated human immunodeficiency virus type 1 infection of macrophages.
12579280 Expression of tetraspanin adaptor proteins below defined threshold values is associated with in vitro invasiveness of mammary carcinoma cells.
12519789 2003 Proteomic and biochemical analyses of human B cell-derived exosomes. Potential implications for their function and multivesicular body formation.
12480921 2002 Complementary DNA arrays identify CD63 tetraspanin and alpha3 integrin chain as differentially expressed in low and high metastatic human colon carcinoma cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12230470 2002 Human macrophages accumulate HIV-1 particles in MHC II compartments.
12175627 2002 Expression of transmembrane 4 superfamily (TM4SF) proteins and their role in hepatic stellate cell motility and wound healing migration.
12036870 2002 C-kit associated with the transmembrane 4 superfamily proteins constitutes a functionally distinct subunit in human hematopoietic progenitors.
11907283 2002 Role of adaptor complex AP-3 in targeting wild-type and mutated CD63 to lysosomes.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
11328596 2001 Dynamics of intracellular granules with CD63-GFP in rat basophilic leukemia cells.
11278880 2001 The major CD9 and CD81 molecular partner. Identification and characterization of the complexes.
11204565 2001 CD63 associates with the alphaIIb beta3 integrin-CD9 complex on the surface of activated platelets.
11113129 2001 Evaluation of prototype transmembrane 4 superfamily protein complexes and their relation to lipid rafts.
10793155 2000 The tetraspanin CD63/lamp3 cycles between endocytic and secretory compartments in human endothelial cells.
10529602 1999 Functional expression of transmembrane 4 superfamily molecules on human eosinophils.
10436028 1999 Characterization of a fourth adaptor-related protein complex.
10405235 1999 Expression of tetraspans transmembrane family in the epithelium of the gastrointestinal tract.
10229664 1999 Selective tetraspan-integrin complexes (CD81/alpha4beta1, CD151/alpha3beta1, CD151/alpha6beta1) under conditions disrupting tetraspan interactions.
9822308 1998 Human bone marrow mast cells from indolent systemic mast cell disease constitutively express increased amounts of the CD63 protein on their surface.
9759843 1998 The tetraspan protein CD82 is a resident of MHC class II compartments where it associates with HLA-DR, -DM, and -DO molecules.
9602068 1998 Characterisation of the mouse homologue of CD151 (PETA-3/SFA-1); genomic structure, chromosomal localisation and identification of 2 novel splice forms.
9360996 1997 NAG-2, a novel transmembrane-4 superfamily (TM4SF) protein that complexes with integrins and other TM4SF proteins.
9360995 1997 Generation of monoclonal antibodies to integrin-associated proteins. Evidence that alpha3beta1 complexes with EMMPRIN/basigin/OX47/M6.
9111230 1997 Localization of the transmembrane 4 superfamily (TM4SF) member PETA-3 (CD151) in normal human tissues: comparison with CD9, CD63, and alpha5beta1 integrin.
9006891 1997 A novel link between integrins, transmembrane-4 superfamily proteins (CD63 and CD81), and phosphatidylinositol 4-kinase.
8871662 1996 CD63 associates with tyrosine kinase activity and CD11/CD18, and transmits an activation signal in neutrophils.
8757325 1996 Transmembrane-4 superfamily proteins CD81 (TAPA-1), CD82, CD63, and CD53 specifically associated with integrin alpha 4 beta 1 (CD49d/CD29).
8661157 1996 Genetic localization of Cd63, a member of the transmembrane 4 superfamily, reveals two distinct loci in the mouse genome.
8630057 1996 CD63 associates with transmembrane 4 superfamily members, CD9 and CD81, and with beta 1 integrins in human melanoma.
7682577 1993 The protein CD63 is in platelet dense granules, is deficient in a patient with Hermansky-Pudlak syndrome, and appears identical to granulophysin.
7629079 1995 Specific association of CD63 with the VLA-3 and VLA-6 integrins.
4062294 1985 Isolation and amino terminal sequencing of a novel melanoma-associated antigen.
3365686 1988 Molecular cloning and characterization of an antigen associated with early stages of melanoma tumor progression.
2516848 1989 Transcriptional enhancement of the human gene encoding for a melanoma-associated antigen (ME491) in association with malignant transformation.
2171551 1990 Characterization of three abundant mRNAs from human ovarian granulosa cells.
1993697 1991 CD63 antigen. A novel lysosomal membrane glycoprotein, cloned by a screening procedure for intracellular antigens in eukaryotic cells.
1879540 1991 Novel structurally distinct family of leucocyte surface glycoproteins including CD9, CD37, CD53 and CD63.
1599482 1992 Genomic structure of the ME491/CD63 antigen gene and functional analysis of the 5'-flanking regulatory sequences.
1435334 1992 Isolation of dense granules from human platelets.
1339263 1992 An ocular melanoma-associated antigen. Molecular characterization.