Property Summary

NCBI Gene PubMed Count 46
PubMed Score 1052.62
PubTator Score 521.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer -1.400 2.4e-02
cutaneous lupus erythematosus 1.800 4.8e-03
psoriasis 1.600 6.7e-04
atypical teratoid / rhabdoid tumor 1.100 1.5e-03
glioblastoma 1.100 8.8e-03
medulloblastoma, large-cell 1.400 5.2e-05
tuberculosis -1.100 1.9e-04
interstitial cystitis 1.400 1.0e-03
pancreatic carcinoma -1.400 2.4e-02
ovarian cancer 1.800 3.1e-10

Gene RIF (29)

PMID Text
26146185 The binding sites on CD6 and CD166 have been characterized to show that a SNP in CD6 causes glycosylation that hinders the CD6/CD166 interaction.
25088497 CD6 regulatory T cells are characterized by CD6 expression and FOXP3 expression.
24945728 interaction of Galectin-1 and -3 with CD6
24890719 upon T cell activation, SRSF1 becomes limiting, and its function in CD6 exon 5 splicing is countered by an increase in CD6 transcription, dependent on chromatin acetylation.
24130718 The CD6 polymorphism conferred reduced odds of optic neuritis as an attack location
23711376 A novel level of regulation of CD6 function by intracytoplasmic serine phosphorylation.
23638056 Our findings reveal that this new MS-associated CD6 risk haplotype significantly modifies expression of CD6 on CD4(+) and CD8(+) T cells.
22994200 In a Korean population, one SNP in CD6 was associated with neuromyelitis optica.
22685579 Data suggest that genetic variations within CD6 and syntaxin binding protein 6 (STXBP6) may influence response to TNFalpha inhibitors in patients with rheumatoid arthritis (RA).
21956609 Cd6 is a signaling attenuator whose expression alone, i.e. in the absence of ligand engagement, is sufficient to restrain signaling in T cells.
21849685 These findings indicate that the multiple sclerosis risk allele in the CD6 locus is associated with altered proliferation of CD4(+) T cells
21552549 association of single nucleotide polymorphisms to multiple sclerosis
21178331 CD6 expression on peripheral NK cells marks a novel CD56(dim) subpopulation associated with distinct patterns of cytokine and chemokine secretion.
20810246 CD6+ B cells are diminished in Sjogren's syndrome
20726988 Data show that CD6-ALCAM interaction in vitro induced a synergistic co-stimulation of normal peripheral blood mononuclear cells.
20430450 Study reinforces a role for CD6 and TNFRSF1A as risk loci for multiple sclerosis, extending to populations of southern European ancestry.
20430450 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19879194 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19865102 Observational study of gene-disease association. (HuGE Navigator)
19525953 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19525953 Replication in an independent set of 2,215 subjects with multiple sclerosis (MS) and 2,116 control subjects validates new MS susceptibility loci at TNFRSF1A, IRF8 and CD6; TNFRSF1A harbors two independent susceptibility alleles.
18707547 A chimpanzee and human conserved CD6 domain 1 epitope recognized by T1 monoclonal antibody.
17601777 Unprecedented bacterial binding properties of recombinant soluble CD6 support its therapeutic potential for the intervention of septic shock syndrome or other inflammatory diseases of infectious origin.
16914752 The costimulatory effect of CD6 is mediated through phosphorylation-dependent binding of a specific tyrosine residue, 662Y, in its cytoplasmic region to the adaptor SLP-76.
16818773 the CD6-ALCAM interaction results in activation of the three MAP kinase cascades, likely influencing the dynamic balance that determines whether resting or activated lymphocytes survive or undergo apoptosis.
16818742 Engagement of CD6 with CD166 on tumor cells plays an important role in gammadelta T cell activation by tumor cells sensitized with nonpeptide antigens endogenously or exogenously.
16034076 CD6 associates with the scaffolding PDZ-containing protein syntenin-1 during maturation of the immunological synapse
12493773 Comprehensive profiling of the cell surface proteome provides an effective approach for the identification of commonly occurring proteins as well as proteins with restricted expression patterns in this compartment.

AA Sequence

MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPAC      1 - 70
GALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVV     71 - 140
EHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQA    141 - 210
LPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEV    211 - 280
HFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLC    281 - 350
SQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIA    351 - 420
FILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYD    421 - 490
FSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTANPGHCITDPPSLGPQYHPRS    491 - 560
NSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPPNLELAGTQPAFSAGPPADDSSSTSSGEWYQ    561 - 630
NFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYDDISAA                                    631 - 668
//

Text Mined References (48)

PMID Year Title
26146185 2015 Structures of CD6 and Its Ligand CD166 Give Insight into Their Interaction.
25088497 2014 Human treg cells are characterized by low/negative CD6 expression.
24945728 2014 Modulation of CD6 function through interaction with Galectin-1 and -3.
24890719 2014 T cell activation regulates CD6 alternative splicing by transcription dynamics and SRSF1.
24584089 2014 Quantitative proteomics analysis of signalosome dynamics in primary T cells identifies the surface receptor CD6 as a Lat adaptor-independent TCR signaling hub.
24130718 2013 Association of multiple sclerosis susceptibility variants and early attack location in the CNS.
23711376 2013 Identification of functionally relevant phoshorylatable serine clusters in the cytoplasmic region of the human CD6 lymphocyte surface receptor.
23638056 2013 Fine mapping and functional analysis of the multiple sclerosis risk gene CD6.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22994200 2013 Associations of CD6, TNFRSF1A and IRF8 polymorphisms with risk of inflammatory demyelinating diseases.
22685579 2012 CD6 and syntaxin binding protein 6 variants and response to tumor necrosis factor alpha inhibitors in Danish patients with rheumatoid arthritis.
21956609 2012 CD6 attenuates early and late signaling events, setting thresholds for T-cell activation.
21849685 2011 The CD6 multiple sclerosis susceptibility allele is associated with alterations in CD4+ T cell proliferation.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21552549 2011 The genetic association of variants in CD6, TNFRSF1A and IRF8 to multiple sclerosis: a multicenter case-control study.
21244703 2011 Modeling the cumulative genetic risk for multiple sclerosis from genome-wide association data.
21178331 2011 The CD6 scavenger receptor is differentially expressed on a CD56 natural killer cell subpopulation and contributes to natural killer-derived cytokine and chemokine secretion.
20810246 2010 Aberrant expression of CD6 on B-cell subsets from patients with Sjögren's syndrome.
20726988 2010 CD6 synergistic co-stimulation promoting proinflammatory response is modulated without interfering with the activated leucocyte cell adhesion molecule interaction.
20430450 2010 Validation of the CD6 and TNFRSF1A loci as risk factors for multiple sclerosis in Spain.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19879194 2009 Integration of genetic risk factors into a clinical algorithm for multiple sclerosis susceptibility: a weighted genetic risk score.
19865102 2010 Multiple sclerosis susceptibility alleles in African Americans.
19525953 2009 Meta-analysis of genome scans and replication identify CD6, IRF8 and TNFRSF1A as new multiple sclerosis susceptibility loci.
18707547 2008 Towards the definition of a chimpanzee and human conserved CD6 domain 1 epitope recognized by T1 monoclonal antibody.
17601777 2007 CD6 binds to pathogen-associated molecular patterns and protects from LPS-induced septic shock.
17371992 2007 Extracellular isoforms of CD6 generated by alternative splicing regulate targeting of CD6 to the immunological synapse.
16914752 2006 CD6 regulates T-cell responses through activation-dependent recruitment of the positive regulator SLP-76.
16818773 2006 Mitogen-activated protein kinase pathway activation by the CD6 lymphocyte surface receptor.
16818742 2006 Involvement of CD166 in the activation of human gamma delta T cells by tumor cells sensitized with nonpeptide antigens.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16352806 2006 Long-term engagement of CD6 and ALCAM is essential for T-cell proliferation induced by dendritic cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16034076 2005 The lymphocyte receptor CD6 interacts with syntenin-1, a scaffolding protein containing PDZ domains.
15294938 2004 Relevance of CD6-mediated interactions in T cell activation and proliferation.
15048703 2004 Frontline: Optimal T cell activation requires the engagement of CD6 and CD166.
12493773 2003 Global profiling of the cell surface proteome of cancer cells uncovers an abundance of proteins with chaperone function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473675 2003 The accessory molecules CD5 and CD6 associate on the membrane of lymphoid T cells.
9436462 1997 CD6 dependent interactions of T cells and keratinocytes: functional evidence for a second CD6 ligand on gamma-interferon activated keratinocytes.
9394826 1997 Analysis of the tyrosine phosphorylation and calcium fluxing of human CD6 isoforms with different cytoplasmatic domains.
9013954 1997 Structure and chromosomal location of the human CD6 gene: detection of five human CD6 isoforms.
7678115 1993 Tyrosine phosphorylation of CD6 by stimulation of CD3: augmentation by the CD4 and CD2 coreceptors.
7589069 1995 Human CD6 possesses a large, alternatively spliced cytoplasmic domain.
7543097 1995 The membrane-proximal scavenger receptor cysteine-rich domain of CD6 contains the activated leukocyte cell adhesion molecule binding site.
3923629 1985 Assignment of gene coding human T-cell differentiation antigen, Tp120, to chromosome 11.
2016320 1991 Biosynthesis and post-translational modification of CD6, a T cell signal-transducing molecule.
1919444 1991 The lymphocyte glycoprotein CD6 contains a repeated domain structure characteristic of a new family of cell surface and secreted proteins.