Property Summary

NCBI Gene PubMed Count 171
PubMed Score 1768.58
PubTator Score 17471.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 2.007 7.4e-03
malignant mesothelioma -1.900 7.9e-08
esophageal adenocarcinoma -1.200 2.8e-02
psoriasis -1.500 9.6e-05
osteosarcoma -1.184 1.8e-02
group 4 medulloblastoma -1.500 5.6e-07
glioblastoma 1.200 1.7e-02
medulloblastoma, large-cell -2.800 1.9e-07
lung cancer -1.600 2.4e-05
breast carcinoma -1.100 5.0e-05
pilocytic astrocytoma 1.500 2.8e-08
inflammatory breast cancer -1.100 4.0e-02
spina bifida -1.064 4.5e-02
acute myeloid leukemia -1.200 2.2e-02
ovarian cancer -2.400 4.1e-07
Down syndrome 1.300 2.9e-03

 GO Function (1)

Gene RIF (110)

PMID Text
26978230 Decreased CD59 expression in threatened miscarriage at late gestational ages leads to additional activation of a maternal immune response and serves as a possible predictor for premature birth.
26772976 Urinary CD59 and alpha-1 antitrypsin are significantly altered in hypertensive patients developing albuminuria.
26738794 Increased internalization of endothelial CD59 in intermittent hypoxia appeared to be cholesterol-dependent and was reversed by statins in a CD59-dependent manner.
26686775 levels of CSF CD59 in neuromyelitis optica and multiple sclerosis
26420021 Low urine CD59 expression is associated with clear cell renal cell carcinoma.
26271970 Data show that the palmitoylation mutation of linker for activation of T cells (LAT)attenuated the signal transduction induced by glycosylphosphatidylinositol-anchored CD59 antigen in T cells.
26218915 Genetic risk at the CFH-to-F13B locus was associated with higher levels of complement activation at the human macular RPE-choroid interface, as was cigarette smoking. Levels of CRP were substantially elevated in risk donors with smoking history.
26136568 After blockage of CD59 function, the reactive Abs, regardless of their neutralizing activities, significantly enhanced specific ADCML of HIV-1 virions
26109641 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25818314 A primary homozygous Cys89Tyr CD59 deficiency in humans resulted in the amino acid substitution p.Cys89Tyr with ensuing failure of proper localization of the CD59 protein to the cell surface. (Review)
25725314 Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy.
25149467 Provirus activation plus CD59 blockage triggers antibody-dependent complement-mediated lysis of latently HIV-1-infected cells.
25149467 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25146331 Data suggest that microRNA-224 directly down-regulates CD59 antigen expression in diffuse large B-cell lymphoma by binding to CD59 3'-untranslated region.
24978917 The expression levels of CD46, CD55, and CD59 were significantly higher in colon cancer tissues compared with the normal adjacent colon tissues.
24924474 Increased CD59 protein expression is associated with the outcome of patients with diffuse large B-cell lymphoma treated with R-CHOP antineoplastic protocol.
24909278 Data indicate that down-regulation of CD59 expression could inhibit HeLa cells' proliferation and promote apoptosis, and the inhibitory effect of peptide seal was better than that of CD59 interference plasmid.
24664706 We found that CD46 and CD59 were decreased in retinal pigment epithelium cells in part, by their release in exosomes and apoptotic particles.
24639397 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
24628556 this study observed robust relationships between a single measurement of blood levels of GCD59 and both acute (2-hour OGTT) and chronic (HbA1c) measures of glucose handling.
24463881 The presence of CD55- and/or CD59-deficient erythrocytic populations in patients with rheumatic diseases reflects an immune-mediated bone-marrow derived phenomenon.
24338025 Sp1 may regulate the expression of CD59, whereas CREB-binding protein (CBP)/p300 bridge NF-kappaB and CREB, which functions as an enhancer-binding protein to induce the up-regulation of CD59 during in lipopolysaccharide (LPS)-triggered complement activation.
24200054 mutation of palmitoylation site of LAT-EGFP attenuated the signal transduction of CD59 in T cells
24167638 Use of AAV2/8-sCD59 warrants further exploration as a potential therapy for advanced stages of diabetic retinopathy
24086391 Hemolytic uremic syndrome evolved independently from CD55 and CD59 expression on peripheral blood cells in enteroaggregative E.coli O104:H4 infected patients.
24084445 Data suggest that CD59 gene might be a genetic locus for the therapy of atherosclerosis.
23835643 CD59 silencing in NSCLC cancer cells via retrovirus-mediated RNAi can enhance complement-mediated cell apoptosis, inhibiting the growth of NSCLC. CD59 may serve as a potential target for gene therapy in NSCLC
23757192 Hematology and diabetes: from hemoglobin A1c to CD59 glycation.
23746236 CD59 was a type of membrane-bound protein, CD59 and Cbp played synergistic roles in cell activation and proliferation.
23670858 a novel, sensitive, and specific ELISA for measuring GCD59 in blood. The assay distinguished individuals with diabetes from those without, and showed strong correlation between GCD59 and HbA1c.
23665225 The primary CD59-ILY binding site is composed of a side-to-side contact between the beta hairpin extension of ILY D4 and the core beta sheet of CD59.
23536680 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
23376460 Data show that increased CD35, CD46, CD55 and CD59 on neutrophils and monocytes present potent markers of bacterial infection and viral infection.
23149847 A Cys89Tyr mutation is associated with improper cell-surface localization of CD59. This mutation is manifested clinically in infancy by chronic hemolysis & relapsing peripheral demyelinating disease.
23049856 HCV incorporates selectively CD59, but not CD46 or CD55, in its envelope to gain resistance to CML in serum of infected individuals
23006730 Data show that in preeclamptic women, diffuse placental C4d was associated with a significantly lower gestational age at delivery, and the mRNA expression of the complement regulatory proteins CD55 and CD59 was significantly upregulated.
22701098 CD59 was expressed both on freshly prepared and frozen-stored samples. Higher level of CD59 was detected on ICAM1+ mesenchymal cells than on nanog+ epithelial cells.
22480874 findings demonstrated that decreased CD59 expression on T cells significantly enhanced activation and proliferation of CD4( ) T cells and CD8( ) T cells; data support that CD59 down-regulates antigen-specific activation of T lymphocytes in a ligand-dependent manner
22293503 Data suggest that HBXIP upregulates CD46, CD55 and CD59 through p-ERK1/2/NF-kappaB signaling to protect breast cancer from complement-dependent cytotoxicity.
22000275 Overexpression of CD59 promoted the proliferation of MCF-7 breast cancer cells and inhibited anti-apoptotic Bcl-2 expression making CD59 a promising target in the gene therapy of breast cancer.
21932413 CD59 is incorporated into both cell line-derived and plasma primary hepatitis C virus virions at levels that protect against antibody-dependent complement-mediated lysis.
21813604 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
21802665 Studies indicate that decreased expression of CD55+ and CD59+ on lymphocyte were found in 11 SLE patients accompanied by lymphocytopenia compared with controls.
21727667 Data show no correlation between degree of expression of RBC surface receptors CR1, CD55 and CD59 with haemoglobin level, but CD55 expression was less in malaria cases than in healthy controls.
21720565 The viability of a non membrane-targeted soluble CD59 to significantly inhibit complement deposition on the endothelium of murine liver vasculature, was demonstrated.
21545652 The lipopolysaccharide of Treponema denticola and Tannerella forsythia were the most potent for increasing the gene expression of CD55 and CD59, and to a lesser extent CD46, after a 48-h stimulation.
21507937 Mapping the intermedilysin-human CD59 receptor interface reveals a deep correspondence with the binding site on CD59 for complement binding proteins C8alpha and C9.
21252115 Data suggest that preemptive elimination of CD59-overexpressing subpopulations along with rituximab treatment may be a useful approach to ablate or conquer rituximab resistance.
21129240 The expression of CD59 became normal after acute promyelocytic leukemia patients achieved complete remission, which indicated that the deficient of CD59 expression was only found in APL blast cells.
20961375 EHD1 is involved in the control of CD59 transport from pre-sorting endosomes to the ERC in a PKC-dependent manner
20727519 there is an altered pattern of CD59 expression on the peripheral blood cells of systemic lupus erythematosus patients;may play a role in the cytopenias
20689133 High CD59 is associated with aplastic anemia.
20638094 The complement regulatory factors CD55 and CD59 were also reduced to a significant extent as a consequence of Adenovirus 11p binding to K562 cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20212283 Transgenic overexpression of human CD59 (hCD59(ICAM-2+/-)/ApoE(-/-)) in this mice model attenuated the progression of abdominal aortic aneurysm.
19955519 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19804910 Hepatitis B virus can sensitize hepatocytes to complement-dependent cytotoxicity through downregulating CD59, which may lead to the activation of complement system and cause liver inflammation.
19781296 CD55 and CD59 expressions on peripheral blood leucocytes are decreased in T2DM patients with macrovascular diseases.
19737458 The release rate of glycated mutanted CD59 was higher than that of unglycated ones in diabetic Vascular Complications.
19686460 CD59 gene was linked with coeliac disease in a family with high incidence of disease and no effects of a synonymous variant within the CD59 gene on its protein product in duodenal biopsies of coeliac individuals was observed.
19662541 In non-Hodgkin lymphoma patients treated with rituximab plus chemotherapy, expression of CD59 was higher in patients with complete remission and in those with bulky disease than in non-responders. CD59 expression may be related to resistance to rituximab.
19622297 A mutation in the W40 site of CD59 reduced inhibition of complement and increased proliferation of ovarian cancer A2780 cells.
19424617 Neutralization of complement regulatory proteins CD55 and CD59 augments therapeutic effect of herceptin against lung carcinoma cells.
19380765 CD59 expression is increased on activated CD4-positive T cells; blocking CD59 on CD4-positive T cells increases the immune response to tumor antigens in individuals with cancer.
19369333 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
19344414 Observational study of gene-disease association. (HuGE Navigator)
19297024 Total plasma cholesterol levels in female CD59(-/-)ApoE(-/-) mice were found to be elevated compared with CD59(+/+)ApoE(-/-) mice.
19254252 Variants within protectin (CD59) genes linked to an inherited haplotype in a family with coeliac disease
19200600 A peptide modeled on the CD59-binding site inhibits intermedilysin-mediated haemolysis suggesting that such peptides might be useful in treating infections caused by intermedilysin-producing bacteria.
19168743 CD59 is trafficked to the cytoplasmic inclusion by a Golgi apparatus-independent pathway during a Chlamydia cell infection. [CD59]
19131645 Complement regulator CD59 protects against atherosclerosis by restricting the formation of complement membrane attack complex.
19116988 In prostate cancer cells in culture, delta-catenin was co-localized with caveolin-1 and CD59, suggesting its potential excretion into extracellular milieu through exosome/prostasome associated pathways.
18954403 Expression levels of CD47, CD35, CD55, and CD59 on red blood cells and signal-regulatory protein-alpha,beta on monocytes from patients with warm autoimmune hemolytic anemia.
18842294 Observational study of gene-disease association. (HuGE Navigator)
18487376 Adenovirus-mediated delivery of hCD59 to retinal pigment epithelium, or cornea culturee protects these cells from membrane attach comlpex-mediated ddamage.
18445344 Results indicate that W40 of human CD59 is important to its activity, and prohibition of this site may be a potential way to increase complement activity and to treat tumors
18443552 erythrocytes are deficient in CD55 and/or CD59 in HIV patients
18362151 up-regulation of CD59 via ERK5/KLF2 activation leads to endothelial resistance to complement-mediated injury and protects from atherogenesis in regions of laminar shear stress
18158579 Paroxysmal nocturnal hemoglobinuria (PNH) is characterized by absence of CD59 from the surface of affected granulocytes.
17671359 Electron-density map of recombinant CD59 crystals shows an as yet unidentified small molecule in the predicted C8/C9-binding site.
17644516 the amount of C5b-9-AF488 bound to K562 cells after complement activation was highly heterogeneous and inversely correlated with the CD59 level of expression
17635812 Essential for the protection of neurons in the NT2-N teratocarcinoma cell line against complement attack.
17585877 These results suggest that IRE1alpha-mediated mRNA cleavage functions even in mammals as a common system to regulate gene expression.
17505110 When compared with previous models of CD59 determined using NMR, some interesting differences are noted, including the position of helix alpha1, which contributes to the binding surface for C8 and C9.
17412968 HHV-7 infection causes elevation of the CRPs CD46 and CD59, which may be a possible mechanism for HHV-7 to evade humoral immunity via complement.
16908271 CD55/59 deficiency in Campath-treated patients with paroxysmal nocturnal hemoglobinuria msay indicate that deficiency could predispose to a complication of this immunosuppressive therapy.
16859540 Upregulation of CD59 and decay-accelerating factor by atorvastatin in hypoxia prevented deposition of C3, C9 and cell lysis that follows exposure of reoxygenated vascular endothelial cells to serum.
16844690 analysis of the CD59-C9 binding interaction
16563273 The expression of CD59 is up-regulated after atorvastatin treatment independently of blood lipids.
16493049 CD59 on target cells enhances the cytotoxicity of natural killer cells, an effect dependent on the glycosylphosphatidylinositol anchor in CD59.
16274631 demonstrated by site-directed mutagenesis that mutated CD59 was more susceptible to glycation-inactivation for hyperglycemia
16179371 CD55-CD59- deficient granulocytes and red blood cells predicts responsse to immunosuppressive agents in aplastic anemia.
15766396 Both mutant CD59 had the anti-complement activity, which was weakened after glycosylation.
15543155 Streptococcus intermedius intermedilysin specifically binds to huCD59 via residues that are the binding site for the C8alpha and C9 complement proteins
15448097 Glycation inactivation of hCD59 leads to increased membrane attack complex deposition may contribute to the extensive vascular pathology that complicates human diabetes.
15389819 Prostasomes from cancer cells had higher expression of CD59 than those of normal cells.
15351205 During respiratory syncytial virus assembly in Hep2 cells, the cellular distribution of the complement regulatory protein, CD59 changes and high levels of this cellular protein are incorporated into mature virus filaments.
15151618 Significant difference in intensity of the staining of CD55 and CD46 among cells in various layers of normal esophageal mucosa and esophageal carcinoma cells, but not in the staining of CD59.
15147772 Presence of CD59 on Purkinje cells at various levels in eight of 14 cases with no cerebellar pathology suggests that Purkinje cells not expressing CD59 could be especially prone to complement-mediated damage.
14962294 Complement regulatory proteins such as MCP and CD59 are expressed in the human and wild-type embryonic brain.
14635045 CD59 is physically associated with NKp46 and NKp30 and activate human nk cell-mediated cytotoxicity.
12880676 Although CD55 and CD59 deficiency in primary or secondary AIHA, it appears that this defect plays a facilitator rather than a triggering role for the hemolytic process.
12646570 CD59 is an adaptor for ecto-calreticulin in neutrophils
12645951 Antigen-presenting cell exosomes are protected from complement-mediated lysis by expression of CD55 and CD59.
12553064 The complement inhibitor CD59 and the lymphocyte function-associated antigen-3 (LFA-3, CD58) genes possess functional binding sites for the p53 tumor suppressor protein.
10786997 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
10708443 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
9263011 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
8887350 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
7539755 HIV-1 Nef induces release of CD59 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP

AA Sequence

MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHC      1 - 70
NFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP                 71 - 128
//

Text Mined References (176)

PMID Year Title
26978230 [Immunomorphological aspects of miscarriage at late gestational ages].
26772976 2016 Urinary alpha-1 antitrypsin and CD59 glycoprotein predict albuminuria development in hypertensive patients under chronic renin-angiotensin system suppression.
26738794 2016 Increased internalization of complement inhibitor CD59 may contribute to endothelial inflammation in obstructive sleep apnea.
26686775 2016 Increased levels of CSF CD59 in neuromyelitis optica and multiple sclerosis.
26420021 2016 Proteomic analysis reveals differentially secreted proteins in the urine from patients with clear cell renal cell carcinoma.
26271970 2015 [Mutation of palmitoylation site of linker for activation of T cells inhibits signal transduction mediated by glycosyl phosphatidyl inositol-anchored CD59 in T cells].
26218915 2015 Assessment of Proteins Associated With Complement Activation and Inflammation in Maculae of Human Donors Homozygous Risk at Chromosome 1 CFH-to-F13B.
26136568 2015 Blockage of CD59 Function Restores Activities of Neutralizing and Nonneutralizing Antibodies in Triggering Antibody-Dependent Complement-Mediated Lysis of HIV-1 Virions and Provirus-Activated Latently Infected Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25818314 2015 Paroxysmal nocturnal hemoglobinuria (PNH) and primary p.Cys89Tyr mutation in CD59: Differences and similarities.
25725314 2015 Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy.
25149467 2014 Provirus activation plus CD59 blockage triggers antibody-dependent complement-mediated lysis of latently HIV-1-infected cells.
25146331 2014 Deregulated expression of miR-224 and its target gene: CD59 predicts outcome of diffuse large B-cell lymphoma patients treated with R-CHOP.
24978917 2014 Systematic immunohistochemical analysis of the expression of CD46, CD55, and CD59 in colon cancer.
24924474 2014 Increased CD59 protein expression is associated with the outcome of patients with diffuse large B-cell lymphoma treated with R-CHOP.
24909278 2014 [Down-regulation of CD59 inhibits proliferation and promotes apoptosis of HeLa cells].
24664706 2014 Oxidized low-density-lipoprotein-induced injury in retinal pigment epithelium alters expression of the membrane complement regulatory factors CD46 and CD59 through exosomal and apoptotic bleb release.
24628556 2014 Glycation of the complement regulatory protein CD59 is a novel biomarker for glucose handling in humans.
24463881 2014 The presence of CD55- and/or CD59-deficient erythrocytic populations in patients with rheumatic diseases reflects an immune-mediated bone-marrow derived phenomenon.
24338025 2014 NF-?B and enhancer-binding CREB protein scaffolded by CREB-binding protein (CBP)/p300 proteins regulate CD59 protein expression to protect cells from complement attack.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24200054 2013 [Impact of the palmitoylation of linker for activation of T cells on signal transduction pathway of CD59 in T cells].
24167638 2013 Adeno-associated virus mediated delivery of a non-membrane targeted human soluble CD59 attenuates some aspects of diabetic retinopathy in mice.
24086391 2013 Increased expression of complement regulators CD55 and CD59 on peripheral blood cells in patients with EAHEC O104:H4 infection.
24084445 Molecular mechanism of inhibitory effects of CD59 gene on atherosclerosis in ApoE (-/-) mice.
24036449 2013 Hepatitis B virus core protein interacts with CD59 to promote complement-mediated liver inflammation during chronic hepatitis B virus infection.
23835643 2013 CD59 is overexpressed in human lung cancer and regulates apoptosis of human lung cancer cells.
23757192 2013 Hematology and diabetes: from hemoglobin A1c to CD59 glycation.
23746236 2013 [Localization and function of CD59 and Cbp in T lymphocytes].
23670858 2013 A specific and sensitive assay for blood levels of glycated CD59: a novel biomarker for diabetes.
23665225 2013 Structural basis for recognition of the pore-forming toxin intermedilysin by human complement receptor CD59.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23376460 2013 Use of complement regulators, CD35, CD46, CD55, and CD59, on leukocytes as markers for diagnosis of viral and bacterial infections.
23149847 2013 CD59 deficiency is associated with chronic hemolysis and childhood relapsing immune-mediated polyneuropathy.
23049856 2012 Specific acquisition of functional CD59 but not CD46 or CD55 by hepatitis C virus.
23006730 2012 Preeclampsia is characterized by placental complement dysregulation.
22701098 2012 Both freshly prepared and frozen-stored amniotic membrane cells express the complement inhibitor CD59.
22480874 2012 Post-transcriptional CD59 gene silencing by siRNAs induces enhanced human T lymphocyte response to tumor cell lysate-loaded DCs.
22293503 2012 HBXIP upregulates CD46, CD55 and CD59 through ERK1/2/NF-?B signaling to protect breast cancer cells from complement attack.
22000275 2011 The effects of CD59 gene as a target gene on breast cancer cells.
21932413 2012 CD59 incorporation protects hepatitis C virus against complement-mediated destruction.
21802665 2011 Reduced expression of CD55 and CD59 on peripheral blood cells from systemic lupus erythematosus: profitable to diagnose some complications?
21727667 2011 Anaemia & expression levels of CD35, CD55 & CD59 on red blood cells in Plasmodium falciparum malaria patients from India.
21720565 2011 Soluble CD59 expressed from an adenovirus in vivo is a potent inhibitor of complement deposition on murine liver vascular endothelium.
21545652 2011 Effect of periodontopathogen lipopolysaccharides and proinflammatory cytokines on CD46, CD55, and CD59 gene/protein expression by oral epithelial cells.
21507937 2011 Mapping the intermedilysin-human CD59 receptor interface reveals a deep correspondence with the binding site on CD59 for complement binding proteins C8alpha and C9.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21252115 2011 Human CD59 inhibitor sensitizes rituximab-resistant lymphoma cells to complement-mediated cytolysis.
21129240 2010 [Acute promyelocytic leukemia with CD59 deficiency].
20961375 2011 Pre-sorting endosomal transport of the GPI-anchored protein, CD59, is regulated by EHD1.
20727519 2010 Expression of CD55 and CD59 on peripheral blood cells from systemic lupus erythematosus (SLE) patients.
20689133 2010 Quantitation of CD55 and CD59 expression on reticulocytes and mature erythrocytes in paroxysmal nocturnal hemoglobinuria, aplastic anemia, and healthy control subjects.
20638094 2010 Adenovirus 11p downregulates CD46 early in infection.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20427317 2010 Selective export of human GPI-anchored proteins from the endoplasmic reticulum.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20212283 2010 Complement regulator CD59 protects against angiotensin II-induced abdominal aortic aneurysms in mice.
19804910 2009 Hepatitis B virus sensitizes hepatocytes to complement-dependent cytotoxicity through downregulating CD59.
19781296 2009 Decreased expression of complement regulatory proteins, CD55 and CD59, on peripheral blood leucocytes in patients with type 2 diabetes and macrovascular diseases.
19737458 2009 [Function of human mutant CD59 molecule on diabetic vascular complication].
19686460 2009 No effects of a synonymous variant within the CD59 gene on its protein product in duodenal biopsies of coeliac individuals.
19662541 2010 Expression of complement regulatory proteins: CD46, CD55, and CD59 and response to rituximab in patients with CD20+ non-Hodgkin's lymphoma.
19622297 2009 [Inhibition of mutant CD59 protein on proliferation of ovarian cancer A2780 cells].
19424617 2009 Neutralization of complement regulatory proteins CD55 and CD59 augments therapeutic effect of herceptin against lung carcinoma cells.
19380765 2009 CD59 blockade enhances antigen-specific CD4+ T cell responses in humans: a new target for cancer immunotherapy?
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19297024 2009 CD59 but not DAF deficiency accelerates atherosclerosis in female ApoE knockout mice.
19254252 2009 Variants within protectin (CD59) and CD44 genes linked to an inherited haplotype in a family with coeliac disease.
19200600 2009 Identification of the high affinity binding site in the Streptococcus intermedius toxin intermedilysin for its membrane receptor, the human complement regulator CD59.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19168743 2009 Host complement regulatory protein CD59 is transported to the chlamydial inclusion by a Golgi apparatus-independent pathway.
19131645 2009 Complement regulator CD59 protects against atherosclerosis by restricting the formation of complement membrane attack complex.
19116988 2009 Identification of extracellular delta-catenin accumulation for prostate cancer detection.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18954403 2009 Expression levels of CD47, CD35, CD55, and CD59 on red blood cells and signal-regulatory protein-alpha,beta on monocytes from patients with warm autoimmune hemolytic anemia.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18487376 2008 Evaluation of adenovirus-delivered human CD59 as a potential therapy for AMD in a model of human membrane attack complex formation on murine RPE.
18445344 2008 Activity after site-directed mutagenesis of CD59 on complement-mediated cytolysis.
18443552 2008 Reduction of CD55 and/or CD59 in red blood cells of patients with HIV infection.
18362151 2008 KLF2-dependent, shear stress-induced expression of CD59: a novel cytoprotective mechanism against complement-mediated injury in the vasculature.
18158579 2008 Detection of CD55- and CD59-deficient granulocytic populations in patients with myelodysplastic syndrome.
17671359 2007 High-resolution structures of bacterially expressed soluble human CD59.
17644516 2007 Live cell imaging of outward and inward vesiculation induced by the complement c5b-9 complex.
17635812 CD59 efficiently protects human NT2-N neurons against complement-mediated damage.
17585877 2007 Site-specific cleavage of CD59 mRNA by endoplasmic reticulum-localized ribonuclease, IRE1.
17566972 2007 Computational approach for identification and characterization of GPI-anchored peptides in proteomics experiments.
17505110 2007 Crystal structure of CD59: implications for molecular recognition of the complement proteins C8 and C9 in the membrane-attack complex.
17412968 2007 Human herpesvirus 7 infection increases the expression levels of CD46 and CD59 in target cells.
16908271 CD55 and CD59 deficiency in transplant patient populations: possible association with paroxysmal nocturnal hemoglobinuria-like symptoms in Campath-treated patients.
16859540 2006 Statin-induced expression of CD59 on vascular endothelium in hypoxia: a potential mechanism for the anti-inflammatory actions of statins in rheumatoid arthritis.
16844690 2006 Defining the CD59-C9 binding interaction.
16602701 2006 Modification-specific proteomics of plasma membrane proteins: identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment.
16563273 2005 [The effect of atorvastatin on the expression of CD55, CD59 in patients with hyperlipidemia].
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16493049 2006 Expression of glycosylphosphatidylinositol-anchored CD59 on target cells enhances human NK cell-mediated cytotoxicity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16274631 2005 The effect of glycation of CD59 on complement-mediated cytolysis.
16179371 2006 Minor population of CD55-CD59- blood cells predicts response to immunosuppressive therapy and prognosis in patients with aplastic anemia.
16032396 2005 Surface protein expression between human adipose tissue-derived stromal cells and mature adipocytes.
15907827 2005 Effect of glycosylphosphatidylinositol specific phospholipase D gene expression levels on complement mediated killing of leukemic cells in patients with chronic myeloid leukemia.
15766396 2005 [Study on mutation, expression and activity of human CD59 gene].
15543155 2004 Human CD59 is a receptor for the cholesterol-dependent cytolysin intermedilysin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15448097 2004 Glycation inactivation of the complement regulatory protein CD59: a possible role in the pathogenesis of the vascular complications of human diabetes.
15389819 2005 Transfer of functional prostasomal CD59 of metastatic prostatic cancer cell origin protects cells against complement attack.
15351205 2004 Analysis of the interaction between respiratory syncytial virus and lipid-rafts in Hep2 cells during infection.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15151618 2004 Complement regulatory proteins in normal human esophagus and esophageal squamous cell carcinoma.
15147772 2004 Heterogeneous expression of CD59 on human Purkinje cells.
14962294 2004 Complement regulatory proteins are expressed at low levels in embryonic human, wild type and transgenic porcine neural tissue.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14635045 2003 CD59 is physically and functionally associated with natural cytotoxicity receptors and activates human NK cell-mediated cytotoxicity.
14517339 2003 Proteomic analysis of glycosylphosphatidylinositol-anchored membrane proteins.
12880676 2003 Deficiency of red cell bound CD55 and CD59 in patients with systemic lupus erythematosus.
12646570 2003 Calreticulin is at the surface of circulating neutrophils and uses CD59 as an adaptor molecule.
12645951 2003 Antigen-presenting cell exosomes are protected from complement-mediated lysis by expression of CD55 and CD59.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12553064 The complement inhibitor CD59 and the lymphocyte function-associated antigen-3 (LFA-3, CD58) genes possess functional binding sites for the p53 tumor suppressor protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12219031 2002 Complement regulatory protein CD59 involves c-SRC related tyrosine phosphorylation of the creatine transporter in skeletal muscle during sepsis.
11477359 2001 Expression of complement regulatory proteins on islets of Langerhans: a comparison between human islets and islets isolated from normal and hDAF transgenic pigs.
11095009 2000 Expression of complement regulatory proteins in the developing human kidney.
10805801 2000 Molecular basis for a link between complement and the vascular complications of diabetes.
10708443 2000 Evidence for budding of human immunodeficiency virus type 1 selectively from glycolipid-enriched membrane lipid rafts.
10341291 1999 CD2-mediated CD59 stimulation in keratinocytes results in secretion of IL-1alpha, IL-6, and GM-CSF: implications for the interaction of keratinocytes with intraepidermal T lymphocytes.
9724629 1998 DPM2 regulates biosynthesis of dolichol phosphate-mannose in mammalian cells: correct subcellular localization and stabilization of DPM1, and binding of dolichol phosphate.
9444417 Complement regulatory proteins in the salivary glands and saliva of Sjögren's syndrome patients and healthy subjects.
9358772 1997 Expression of the complement regulatory proteins decay accelerating factor (DAF, CD55), membrane cofactor protein (MCP, CD46) and CD59 in the normal human uterine cervix and in premalignant and malignant cervical disease.
9238658 1996 Complement-binding proteins are strongly expressed by human preimplantation blastocysts and cumulus cells as well as gametes.
9235986 1997 Mapping the regions of the complement inhibitor CD59 responsible for its species selective activity.
9054419 1997 The glycosylation of the complement regulatory protein, human erythrocyte CD59.
9053451 1997 Mutational analysis of the active site and antibody epitopes of the complement-inhibitory glycoprotein, CD59.
8995588 1997 Expression of CD59, a regulator of the membrane attack complex of complement, on human skeletal muscle fibers.
8969267 1996 Protection of human nasal respiratory epithelium from complement-mediated lysis by cell-membrane regulators of complement activation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8876826 1996 Human complement regulator expression by the normal female reproductive tract.
8798614 1996 Elimination of potential sites of glycosylation fails to abrogate complement regulatory function of cell surface CD59.
8789559 1996 Identification of the complement regulatory protein CD59 in human colostrum and milk.
8670172 1996 Structural composition and functional characterization of soluble CD59: heterogeneity of the oligosaccharide and glycophosphoinositol (GPI) anchor revealed by laser-desorption mass spectrometric analysis.
8650218 1996 The association between glycosylphosphatidylinositol-anchored proteins and heterotrimeric G protein alpha subunits in lymphocytes.
8526992 1995 Immunohistochemical localization of C9 neoantigen and the terminal complement inhibitory protein CD59 in human endometrium.
8276756 1993 Determination of carboxyl-terminal residue and disulfide bonds of MACIF (CD59), a glycosyl-phosphatidylinositol-anchored membrane protein.
7691713 1993 Colocalization of the human CD59 gene to 11p13 with the MIC11 cell surface antigen.
7686996 1993 Expression of CD59, a regulator of the membrane attack complex of complement, on human astrocytes.
7683594 1993 Localization of the human CD59 gene by fluorescence in situ hybridization and pulsed-field gel electrophoresis.
7673728 1995 Differential expression of complement receptors on human basophils and mast cells. Evidence for mast cell heterogeneity and CD88/C5aR expression on skin mast cells.
7553895 1995 Expression of GPI-anchored complement regulatory proteins CD55 and CD59 differentiates two subpopulations of human CD56+ CD3- lymphocytes (NK cells).
7544344 1995 Identity of the segment of human complement C8 recognized by complement regulatory protein CD59.
7530684 1994 The expression of CD59 in normal human nervous tissue.
7523406 1994 Identity of a peptide domain of human C9 that is bound by the cell-surface complement inhibitor, CD59.
7520819 1994 Structure of a soluble, glycosylated form of the human complement regulatory protein CD59.
7515200 1994 Protection of porcine aortic endothelial cells from complement-mediated cell lysis and activation by recombinant human CD59.
7512825 1994 Three-dimensional solution structure of the extracellular region of the complement regulatory protein CD59, a new cell-surface protein domain related to snake venom neurotoxins.
7505007 1993 Differential expression of the complement regulatory proteins in the human eye.
2606909 1989 Molecular cloning and characterization of MACIF, an inhibitor of membrane channel formation of complement.
2476718 1989 Complementary DNA sequence and deduced peptide sequence for CD59/MEM-43 antigen, the human homologue of murine lymphocyte antigen Ly-6C.
2475570 1989 CD59, an LY-6-like protein expressed in human lymphoid cells, regulates the action of the complement membrane attack complex on homologous cells.
2475111 1989 20 KDa homologous restriction factor of complement resembles T cell activating protein.
2302178 1990 Isolation and characterization of a membrane-attack-complex-inhibiting protein present in human serum and other biological fluids.
1702747 1990 Protection of human amniotic epithelial cells (HAEC) from complement-mediated lysis: expression on the cells of three complement inhibitory membrane proteins.
1699124 1990 Inherited complete deficiency of 20-kilodalton homologous restriction factor (CD59) as a cause of paroxysmal nocturnal hemoglobinuria.
1692709 1990 Isolation and expression of the full-length cDNA encoding CD59 antigen of human lymphocytes.
1689664 1990 The CD59 antigen is a structural homologue of murine Ly-6 antigens but lacks interferon inducibility.
1383553 1992 Gene structure of human CD59 and demonstration that discrete mRNAs are generated by alternative polyadenylation.
1383132 1992 Characterization of the membrane attack complex inhibitory protein CD59 antigen on human amniotic cells and in amniotic fluid.
1382994 1992 Paroxysmal nocturnal hemoglobinuria due to hereditary nucleotide deletion in the HRF20 (CD59) gene.
1381503 1992 Structure of the CD59-encoding gene: further evidence of a relationship to murine lymphocyte antigen Ly-6 protein.
1377690 1992 The human complement regulatory protein CD59 binds to the alpha-chain of C8 and to the "b"domain of C9.
1377404 1992 Overlapping but nonidentical binding sites on CD2 for CD58 and a second ligand CD59.
1376264 1992 Complement regulatory proteins at the feto-maternal interface during human placental development: distribution of CD59 by comparison with membrane cofactor protein (CD46) and decay accelerating factor (CD55).
1372592 1992 Expression and function of membrane attack complex inhibitory proteins on thyroid follicular cells.