1. Home
  2. Targets
  3. cell adhesion molecule
  4. protease
  5. serine protease
  6. Complement decay-accelerating factor

Tbio Complement decay-accelerating factor

(Microbial infection) Acts as a receptor for coxsackievirus A21, coxsackieviruses B1, B3 and B5 (PubMed:9151867). Acts as a receptor for human enterovirus 70 and D68 (Probable) (PubMed:8764022). Acts as a receptor for human echoviruses 6, 7, 11, 12, 20 and 21 (PubMed:7525274).

This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins. [provided by RefSeq, Jul 2014]

 Comments

Property Summary

NCBI Gene PubMed Count 194
PubMed Score 1054.37
PubTator Score 767.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (32)

Disease log2 FC p
Endometriosis -1.621 3.6e-02
interstitial lung disease -1.100 1.7e-02
malignant mesothelioma -1.300 1.3e-06
astrocytic glioma -2.200 3.5e-02
oligodendroglioma -2.300 3.3e-02
Barrett's esophagus 2.400 2.0e-02
esophageal adenocarcinoma 2.700 1.8e-02
acute quadriplegic myopathy 1.031 1.3e-03
Atopic dermatitis -1.500 1.5e-04
adrenocortical carcinoma -2.415 8.6e-05
tuberculosis and treatment for 6 months -1.500 7.0e-05
primary pancreatic ductal adenocarcinoma 2.326 1.2e-02
non-small cell lung cancer -2.082 3.3e-18
Common variable immunodeficiency -1.254 2.8e-03
intraductal papillary-mucinous adenoma (... 3.000 2.2e-04
intraductal papillary-mucinous carcinoma... 4.200 6.5e-06
intraductal papillary-mucinous neoplasm ... 3.900 1.3e-03
lung cancer -4.400 9.2e-07
ulcerative colitis 3.700 4.5e-09
pancreatic cancer 2.300 9.2e-07
interstitial cystitis -1.200 9.6e-04
adult high grade glioma -1.300 9.7e-03
group 4 medulloblastoma -1.500 1.2e-03
lung adenocarcinoma -1.300 1.0e-04
nasopharyngeal carcinoma -2.100 8.1e-05
lung carcinoma -2.200 6.0e-42
spina bifida -1.869 3.9e-02
Breast cancer -1.600 8.8e-10
gastric carcinoma 2.900 2.3e-02
ovarian cancer 1.900 1.9e-03
Down syndrome 1.200 5.1e-05
dermatomyositis 1.300 4.0e-03

Synonym

Accession P08174 B1AP14 D3DT83 D3DT84 E7ER69 P09679 P78361 Q14UF2 Q14UF3 Q14UF4 Q14UF5 Q14UF6
Symbols CR
TC
DAF
CROM

Gene

CD55

PANTHER Protein Class (3)

PDB

5FOA   1H03   1H04   1H2P   1H2Q   1M11   1NWV   1OJV   1OJW   1OJY   1OK1   1OK2   1OK3   1OK9   1UOT   1UPN   2C8I   2QZD   2QZF   2QZH   3IYP   3J24  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (23)

See all...

 GO Function (2)

 GO Component (10)

 GO Process (11)

See all...

 Compartment GO Term (54)

See all...

 OMIM Phenotype (1)

 MGI Phenotype (8)

 HCA RNA Cell Line (56)

See all...

 CSPA Cell Line (40)

See all...

Pathway (25)

See all...

Protein-protein Interaction (44)

DCTN6   DYNC1I1   GOSR2   SPTBN2   YKT6   DYNC1LI2   USO1   DCTN3   GOSR1   INS   SPTA1   C4B   C4B   SPTB   FOLR1   KDELR1   TMED10   DYNLL1   SPTBN1   GOLGA2   TMEM115   STX5   DYNC1I2   DCTN2   SPTAN1   DCTN1   DYNC1H1   GOLGB1   TMED2   ARFGAP2   GBF1   DYNLL2   GORASP1   DCTN5   TMED9   RAB1B   SPTBN4   SPTBN5   BET1L   DCTN4   TMED7   TMED3   DYNC1LI1   CHI3L1  

Gene RIF (139)

PMID Text
26202380 Over expression of CD55 in brushing samples taken from Barrett's esophagus
26107567 present study suggested that the expressions of CD97 antigen and decay accelerating factor DAF were both upregulated in human cervical squamous cell carcinoma
25954012 CD55 is an essential host factor for P. falciparum invasion. CD55-null erythrocytes were refractory to invasion by all isolates of P. falciparum because parasites failed to attach properly to the erythrocyte surface.
25797618 conclude that CD55 expression is affected by glycemic status in human islets and plays a critical role in maintaining the conserved structure of rafts in pancreatic islets, which is similar to that of the related complement inhibitor CD59
25759385 HIV-1 Gag co-localizes with the lipid raft marker CD55 or the tetraspanin CD81 in HeLa P4-R5 cells
25725314 Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy.
25653430 Expression of human decay-accelerating factor on intestinal epithelium of transgenic mice does not facilitate coxsackievirus B3 infection by the enteral route.
25457880 DAF rs10746463 polymorphism effects on the risk of developing gastric cancer in Chinese population.
25392210 Taken together, these results support the current model of coxsackievirus B3-DAF interaction and point to a specific role for viral VP1 T271 and DAF S104 at the virus-DAF interface.
25026028 Data suggest that CD55 (but not CD59) on red blood cells is down-regulated in subjects with beta-thalassemia major as compared to control subjects; CD55 expression is intermediate on patients with beta-thalassemia intermedia.
24978917 The expression levels of CD46, CD55, and CD59 were significantly higher in colon cancer tissues compared with the normal adjacent colon tissues.
24973443 Anti-epidermal growth factor receptor (EGFR)-IgG3 antibody weakly promotes assembly of classical C3 convertase that is further suppressed in the presence of CD55, forcing human IgG3 to act mainly through the alternative pathway amplification route.
24763553 the use of alpha-gal as antigen to induce tumor cell killing may be a potential therapeutic strategy in colon cancer and that CD55 plays a primary role in conferring resistance to lysis
24639397 HIV-1 Gag co-localizes with the lipid raft marker CD55 or the tetraspanin CD81 in HeLa P4-R5 cells
24599886 Authors showed that the PI3K/Akt pathway negatively regulated the expression of DAF on the epithelial cell surface and thus inhibited the adhesion of Dr(+) E. coli to epithelial cells.
24463881 The presence of CD55- and/or CD59-deficient erythrocytic populations in patients with rheumatic diseases reflects an immune-mediated bone-marrow derived phenomenon.
24198281 CD55 acts as a potent costimulator and activator of human naive CD4(+) cells, resulting in the differentiation of a discrete Tr1 population that inhibits T cell function in an IL-10-dependent manner and maintains the Tr1 phenotype upon restimulation.
24086391 Hemolytic uremic syndrome evolved independently from CD55 and CD59 expression on peripheral blood cells in enteroaggregative E.coli O104:H4 infected patients.
23692281 The pattern of expression of the CD55(int7+) isoforms in normal and cancer tissues, were determined.
23658447 hepatitis C virus (HCV) infection of hepatocytes or HCV core protein expression in transfected hepatocytes upregulated CD55 expression at the mRNA and protein levels
23427180 hCG plays a role in embryo-endometrium communication and affects the expression of C3 and DAF in endometrial compartments during the implantation window.
23402020 we present a concise historic prospective and a summary of accumulated knowledge on steroid hormones, DAF expression, and therapeutic implication of steroid hormone treatment--{review}
23390291 Crry deletion from DAF-deficient mouse platelets cause abnormal platelet turnover, leading to compensatory increase in thrombopoiesis.
23376460 Data show that increased CD35, CD46, CD55 and CD59 on neutrophils and monocytes present potent markers of bacterial infection and viral infection.
23176121 Data indicate that nitric oxide downregulates decay accelerating factor (DAF) expression by inhibiting its promoter activity possibly through a decreased binding of Sp1 in association of HuR.
23152895 vitamin D3 signaling may promote an anti-inflammatory response through an NF-kappaB-dependent increase in CD55 expression.
23049856 HCV incorporates selectively CD59, but not CD46 or CD55, in its envelope to gain resistance to CML in serum of infected individuals
23042280 The aim of this study was to determine the transcript and protein levels of complement decay-accelerating factor (DAF) and membrane cofactor protein (MCP) in the placentas of women with acquired and inherited thrombophilia.
23006730 Data show that in preeclamptic women, diffuse placental C4d was associated with a significantly lower gestational age at delivery, and the mRNA expression of the complement regulatory proteins CD55 and CD59 was significantly upregulated.
22961402 CD55 polymorphisms are not genetic markers of aspirininduced bronchospasm, including FEV1, in the population studied.
22830021 HIV-1 Gag co-localizes with the lipid raft marker CD55 or the tetraspanin CD81 in HeLa P4-R5 cells
22761385 mumps virus (MuV) and vesicular stomatitis virus (VSV) assemble to include CD46 and CD55, two host cell regulators which inhibit propagation of complement pathways through distinct mechanisms.
22693232 In conclusion, CD55 polymorphisms are associated with severe 2009 pandemic H1N1 influenza A virus infection.
22574734 Using biochemical and cell biological approaches in a uterine epithelial cell model (Ishikawa cells), DAF accumulates in caveolae upon exposure to nitrogen oxide.
22553215 DiMNF can repress the cytokine-mediated induction of CD55 mRNA and protein.
22547928 CD97 and CD55 showed high expression at the invasive front of gallbladder carcinoma. CD97 and CD55 expression was associated with high histologic grade, advanced pathologic T stage, clinical stage and positive venous/lymphatic invasion.
22445689 It was shown that a single amino acid substitution in the capsid protein VP2 of Echovirus 11 could control the expression of the DAF-dependent phenotype.
22293503 Data suggest that HBXIP upregulates CD46, CD55 and CD59 through p-ERK1/2/NF-kappaB signaling to protect breast cancer from complement-dependent cytotoxicity.
22206234 CD55 levels decrease on red blood cell of all ages during new onset malarial anaemia.
21802665 Studies indicate that decreased expression of CD55+ and CD59+ on lymphocyte were found in 11 SLE patients accompanied by lymphocytopenia compared with controls.
21727667 Data show no correlation between degree of expression of RBC surface receptors CR1, CD55 and CD59 with haemoglobin level, but CD55 expression was less in malaria cases than in healthy controls.
21545652 The lipopolysaccharide of Treponema denticola and Tannerella forsythia were the most potent for increasing the gene expression of CD55 and CD59, and to a lesser extent CD46, after a 48-h stimulation.
21518786 results provide evidence that hDAF plays a central role in the early events of Escherichia coli Afa/Dr DAEC pathogenesis, including bacterial adherence and the establishment of cellular responses
21420451 The authors found that DAF expression allowed attachment of both haemagglutinating and non-haemagglutinating echovirus 6 strains but was not sufficient for promoting echovirus 6 cell entry.
21380985 Women with a diagnosis of preterm labor have increased decay-accelerating factor (DAF) expression on peripheral white blood cells. Failure to elevate DAF expression may be associated with a risk of early premature delivery.
20727519 there is an altered pattern of CD55 expression on the peripheral blood cells of systemic lupus erythematosus patients;may play a role in the cytopenias
20727121 HIV-1 Gag co-localizes with the lipid raft marker CD55 or the tetraspanin CD81 in HeLa P4-R5 cells
20692039 show here that the 3'UTR of DAF contains an adenylate uridine rich element (ARE) AUUUAUUUAUAUUUAUUUA, which belongs to Class II Cluster 4 of the AU-rich element-containing mRNA (ARED) database
20689133 High CD55 is associated with aplastic anemia.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20638094 The complement regulatory factors CD55 and CD59 were also reduced to a significant extent as a consequence of Adenovirus 11p binding to K562 cells.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20339853 Elevated expression of CD97 and its ligand CD55 at the invasion front correlate with tumor recurrence and metastasis, and CD95 may be a poor prognostic factor for rectal adenocarcinoma.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19878546 DAF and MCP regulate cell survival of human cervical cancer cells.
19781296 CD55 and CD59 expressions on peripheral blood leucocytes are decreased in T2DM patients with macrovascular diseases.
19729796 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19710132 These results indicate that CVB3 entry into nonpolarized HeLa cells differs significantly from entry into polarized Caco-2 cells and is not influenced by virus binding to DAF.
19681921 DAF is one of the genes involved in conferring susceptibility to allergic respiratory diseases and show that decreased levels of DAF may be associated with the enhanced specific IgE responses occurring in allergic diseases in the Japanese population.
19681921 Observational study of gene-disease association. (HuGE Navigator)
19675582 at critical periods during autoimmune MG, this SNP may result in inadequate DAF upregulation with consequent complement-mediated EOM damage.
19662541 In non-Hodgkin lymphoma patients treated with rituximab plus chemotherapy, expression of CD55 was higher in patients with bulky disease. CD55 expression may be related to resistance to rituximab.
19424617 Neutralization of complement regulatory proteins CD55 and CD59 augments therapeutic effect of herceptin against lung carcinoma cells.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19364072 Human islet allotransplantation might be more successful if either de novo transfer of DAF onto the isolated islets or new techniques for islet isolation preserving DAF could be developed.
19344414 Observational study of gene-disease association. (HuGE Navigator)
19341386 CD55 may be a useful predictor of subsequent preterm labor/birth.
18997004 Three blood group antigens genes, namely CD55, CD151, and SLC14A1, have been subjected to balancing selection, a process, rare outside MHC genes, which maintains variability at a locus.
18842294 Observational study of gene-disease association. (HuGE Navigator)
18676748 CD55 plays an important role in tumorigenesis of breast cancer
18579524 H. pylori induces DAF expression in human gastric epithelial cells
18524812 Data show that mRNA expression of DAF was significantly increased throughout the window of implantation.
18443552 erythrocytes are deficient in CD55 and/or CD59 in HIV patients
18374870 Expression of DAF on cardiac allografts may provide an immunoprotective mechanism against the deleterious effects of complement deposition in patients with antibody-mediated cardiac allograft rejection.
18305044 Old World hantaviruses Hantaan and Puumala enter polarized target cells from the apical site and DAF is a critical cofactor for infection.
18165780 Role of the GPIIb/IIIa inhibitor tirofiban for the prevention of hDAF pig heart rejection and xenograft function.
18158579 Paroxysmal nocturnal hemoglobinuria (PNH) is characterized by absence of CD55 from the surface of affected granulocytes.
17893077 A fragment of DAF was used to determine its structure.
17449467 CD55 may simultaneously regulate both the innate and adaptive immune responses and can also regulate complement when bound to CD97.
17395591 DAF active site residues accelerate the decay of C3 convertases
17368771 this study, identifies only one mutation in DAF in 46 patients with aHUS. This mutation, I197V, does not impair complement regulation and cannot be implicated in the pathogenesis of aHUS in this patient
17182573 The second short consensus repeat (SCR) domain of DAF (SCR2) interacts only with Bb, whereas SCR4 interacts with C3b.
16980062 In transgenic pigs, shows a protective effect for the complement-mediated cytotoxicity induced by human xenoreactive antibodies.
16908271 CD55/59 deficiency in Campath-treated patients with paroxysmal nocturnal hemoglobinuria msay indicate that deficiency could predispose to a complication of this immunosuppressive therapy.
16818763 Direct stimulation of CD55 on CD4-positive T cells with CD97 can modulate T cell activation but does not interfere with CD55-mediated complement regulation.
16647457 In hDAF-transgenic pig hearts perfused with unmodified human blood the subendocardial/subepicardial blood flow ratio changed in favor of the subepicardium.
16626483 Observational study of gene-disease association. (HuGE Navigator)
16563273 The expression of CD55 is down-regulated in hyperlipidemia and is related with complement activation.
16543227 A study evaluating whether H. pylori utilizes DAF as a receptor and the role of DAF within H. pylori-infected gastric mucosa is presented.
16533428 CD55 has a role in prostate cancer growth and survival
16367924 Introduction of this siRNA decreased CD55 expression in the breast cancer cell line
16273233 Transcript level of CD55 was higher in tumors than those in the margin and normal epithelial mucous tissues.
16179371 CD55-CD59- deficient granulocytes and red blood cells predicts responsse to immunosuppressive agents in aplastic anemia.
16079188 Thrombin-induced DAF expression involves transactivation of PAR2 by PAR1 and signaling via PKC-epsilon/MAPK.
15919505 DAF transgenic pig hearts are rejected by cynomolgus monkeys.
15831949 swine vesicular disease virus isolates from early and recent outbreaks have been compared for their capacity to utilize the progenitor virus receptors coxsackie-adenovirus receptor and decay-accelerating factor
15808692 Protective role of hDAF in pig cells to heterologus complement mediated damage in vitro.
15808686 Transgenic human DAF improves the performance of pig hearts by reducing myocardial damage and intravascular thrombosis after heart translpantation.
15808683 Hyperacute xenograft rejection of pig hearts into baboons was prevented by immunosorption and human DAF transgenic donor hearts.
15808680 hDAF transgene blocks hyperacute graft rejection of porcie islets into alloxan diabetic ratsl
15721309 a splice variant of decay-accelerating factor is expressed in c-erbB-2-positive mammary carcinoma cells showing increased transendothelial invasiveness
15596863 interaction of DAF-binding coxsackievirus B3 isolate with soluble or cell surface DAF did not induce formation of A particles
15536079 DAF has a role in controlling the complement cascade
15385816 Does not provide additional bbenefit in preventing graft rejection in transgenic pig-baboon heart transplantation.
15356143 For DAF to function on natural killer (NK) cells, short consensus repeat motifs 2-4 of DAF are required. Downregulation by DAF expression in NK cell-mediated pig endothelial cell lysis is distinct, and very effective.
15351205 During respiratory syncytial virus assembly in Hep2 cells, the cellular distribution of the complement regulatory protein, decay accelerating factor (CD55) changes and high levels of this cellular protein are incorporated into mature virus filaments.
15350460 In transgenic swine, significantly increased survival time of kidney xenograft to baboons.
15284224 Use of PKC agonists and isozyme-specific pseudosubstrate peptide antagonists suggested a role for PKCalpha and -epsilon in VEGF-mediated DAF up-regulation, mediating A cytoprotective pathway in ECs.
15151618 Significant difference in intensity of the staining of CD55 and CD46 among cells in various layers of normal esophageal mucosa and esophageal carcinoma cells, but not in the staining of CD59.
15102803 in vitro E. coli invasion of an epithelial cell line is directly related to NO-regulated expression of DAF
15102687 CD55 and CD59 have roles in preventing progression of breast carcinomas
15007307 UEA-1 agglutinin binds to DAF in colonic mucosa and the product is excreted in feces of patients with colon cancer and colitis.
15007304 Serum DAF concentrations are increased in ulcerative colitis patients in relation to disease activity.
14993659 Regions of DAF interact wiwth enteroviruses and may predict specific virus-receptor contacts.
14962294 Pigs transgenic for human DAF express very low levels of human DAF on embryonic neural tissue.
14734808 interaction with the convertase, and thus complement regulation, depends on the burial of a hydrophobic patch centered on the linker between SCR domains 2 and 3.
14722298 community-circulating strains of Coxsackie virus A21 can infect target cells expressing intercellular adhesion molecule 1 or DAF alone and that such interactions extend tissue tropism and impact directly on viral pathogenesis.
14530374 Antiadhesive role of apical decay-accelerating factor (CD55) in human neutrophil transmigration across mucosal epithelia.
12950987 In transgenic pigs, delays xenograft heart rejection in baboons treated with immunosuppressive agents.
12920584 Since DAF is abundantly expressed in epithelial and endothelial cells, interaction of cardiotropic Coxsackie Virus B with the DAF coreceptor protein, in addition to CAR, could therefore be advantageous to the virus by enhancing viral entry into the heart.
12880676 Although CD55 and CD59 deficiency in primary or secondary AIHA, it appears that this defect plays a facilitator rather than a triggering role for the hemolytic process.
12811528 Enhanced expression of the complement regulatory protein CD55 is associated with colorectal cancer
12731067 a new functional role of CD55 as a member of a multimeric LPS receptor complex.
12672958 DAF seems to occupy a groove on the CP convertase such that both faces of DAF close to the 2-3 junction (including a positively charged region that encircles the protein at this point) interact simultaneously.
12664211 hCD55 expressed in rat hearts not only inhibits complement activation, but also human leukocyte adhesion and apparently functions as an anti-adhesion molecule
12659837 In neutrophils, GPI-anchored normal cellular prion and this protein exhibit different biological properties.
12654791 Afa/Dr diffusely adhering E. coli induced IL-8 production and transepithelial migration of polymorphonuclear leukocytes in polarized monolayers of the T84 cell line; after PMNL migration, expression of DAF was enhanced, increasing the bacterial adhesion
12645951 Antigen-presenting cell exosomes are protected from complement-mediated lysis by expression of CD55 and CD59.
12499389 x-ray structure of a pathogen-binding fragment of human CD55 at 1.7 angstrom resolution containing two of the three domains required for regulation of human complement
12445304 VEGF produced by tumours to stimulate angiogenesis, also up-regulates endothelial cell surface expression of CD55 and stimulates the release of matrix degrading metalloproteinases.
12393518 The role of DAF in regulating alternative and classical pathway C3 activation was investigated.
12186929 results indicate that interaction with DAF on the apical surface of polarized epithelial cells facilitates infection by a subset of coxsackie B virus isolates
12117960 identify the important Dr adhesin-binding and comlplement regulatory residues of human decay-accelerating factor SCR-3
11983016 The expression of hMCP on tissues where hDAF is not expressed could provide these tissues with protection against human complement mediated lysis.
11832343 bFGF and VEGF were synergistic in terms of DAF expression, resulting in enhanced endothelial cytoprotection
8887350 HIV-1 Gag co-localizes with the lipid raft marker CD55 or the tetraspanin CD81 in HeLa P4-R5 cells
7535292 HIV-1 Gag co-localizes with the lipid raft marker CD55 or the tetraspanin CD81 in HeLa P4-R5 cells

AA Sequence 

MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFV      1 - 70
KIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLS     71 - 140
PKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSS    141 - 210
VQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPP    211 - 280
PECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSG    281 - 350
TTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT                                           351 - 381
//

Text Mined References (199)

PMID Year Title
26207632 2015 Obif, a Transmembrane Protein, Is Required for Bone Mineralization and Spermatogenesis in Mice.
26202380 2016 Overexpression of CD55 from Barrett's esophagus is associated with esophageal adenocarcinoma risk.
26107567 2015 Immunohistochemical Expression and Prognostic Significance of CD97 and its Ligand DAF in Human Cervical Squamous Cell Carcinoma.
25954012 2015 Malaria. A forward genetic screen identifies erythrocyte CD55 as essential for Plasmodium falciparum invasion.
25797618 2015 Complement inhibitor CD55 governs the integrity of membrane rafts in pancreatic beta cells, but plays no role in insulin secretion.
25725314 2015 Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy.
25653430 2015 Expression of human decay-accelerating factor on intestinal epithelium of transgenic mice does not facilitate infection by the enteral route.
25457880 2015 The tag SNP rs10746463 in decay-accelerating factor is associated with the susceptibility to gastric cancer.
25392210 2015 Specificity of coxsackievirus B3 interaction with human, but not murine, decay-accelerating factor: replacement of a single residue within short consensus repeat 2 prevents virus attachment.
25026028 2014 Expression of CD55 on red blood cells of ?-thalassemia patients.
24978917 2014 Systematic immunohistochemical analysis of the expression of CD46, CD55, and CD59 in colon cancer.
24973443 2014 Epidermal growth factor receptor targeting IgG3 triggers complement-mediated lysis of decay-accelerating factor expressing tumor cells through the alternative pathway amplification loop.
24763553 2014 CD55 limits sensitivity to complement-dependent cytolysis triggered by heterologous expression of ?-gal xenoantigen in colon tumor cells.
24599886 2014 PI3K/Akt pathway restricts epithelial adhesion of Dr + Escherichia coli by down-regulating the expression of decay accelerating factor.
24463881 2014 The presence of CD55- and/or CD59-deficient erythrocytic populations in patients with rheumatic diseases reflects an immune-mediated bone-marrow derived phenomenon.
24198281 2013 CD55 costimulation induces differentiation of a discrete T regulatory type 1 cell population with a stable phenotype.
24086391 2013 Increased expression of complement regulators CD55 and CD59 on peripheral blood cells in patients with EAHEC O104:H4 infection.
23692281 2013 Characterization of novel CD55 isoforms expression in normal and neoplastic tissues.
23658447 2013 Hepatitis C virus infection upregulates CD55 expression on the hepatocyte surface and promotes association with virus particles.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23427180 2013 Complement C3 and decay-accelerating factor expression levels are modulated by human chorionic gonadotropin in endometrial compartments during the implantation window.
23402020 2013 DAF as a therapeutic target for steroid hormones: implications for host-pathogen interactions.
23390291 2013 Deletion of Crry and DAF on murine platelets stimulates thrombopoiesis and increases factor H-dependent resistance of peripheral platelets to complement attack.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23376460 2013 Use of complement regulators, CD35, CD46, CD55, and CD59, on leukocytes as markers for diagnosis of viral and bacterial infections.
23176121 2013 Role of transcription factor Sp1 and RNA binding protein HuR in the downregulation of Dr+ Escherichia coli receptor protein decay accelerating factor (DAF or CD55) by nitric oxide.
23152895 2012 1,25-Dihydroxyvitamin D3 promotes a sustained LPS-induced NF-?B-dependent expression of CD55 in human monocytic THP-1 cells.
23049856 2012 Specific acquisition of functional CD59 but not CD46 or CD55 by hepatitis C virus.
23042280 2012 Complement inhibitory proteins expression in placentas of thrombophilic women.
23006730 2012 Preeclampsia is characterized by placental complement dysregulation.
22961402 2012 CD55 polymorphisms and risk of aspirin?exacerbated respiratory disease.
22761385 2012 Virion-associated complement regulator CD55 is more potent than CD46 in mediating resistance of mumps virus and vesicular stomatitis virus to neutralization.
22693232 2012 A functional variation in CD55 increases the severity of 2009 pandemic H1N1 influenza A virus infection.
22590509 2012 Triggering of the dsRNA sensors TLR3, MDA5, and RIG-I induces CD55 expression in synovial fibroblasts.
22574734 2012 Nitric oxide induces segregation of decay accelerating factor (DAF or CD55) from the membrane lipid-rafts and its internalization in human endometrial cells.
22553215 2012 Selective aryl hydrocarbon receptor modulator-mediated repression of CD55 expression induced by cytokine exposure.
22547928 2012 Immunohistochemical expression and prognostic value of CD97 and its ligand CD55 in primary gallbladder carcinoma.
22445689 2012 A single amino acid substitution controls DAF-dependent phenotype of echovirus 11 in rhabdomyosarcoma cells.
22391577 2012 Human CD55 expression blocks hyperacute rejection and restricts complement activation in Gal knockout cardiac xenografts.
22293503 2012 HBXIP upregulates CD46, CD55 and CD59 through ERK1/2/NF-?B signaling to protect breast cancer cells from complement attack.
22206234 2011 Early and extensive CD55 loss from red blood cells supports a causal role in malarial anaemia.
21802665 2011 Reduced expression of CD55 and CD59 on peripheral blood cells from systemic lupus erythematosus: profitable to diagnose some complications?
21727667 2011 Anaemia & expression levels of CD35, CD55 & CD59 on red blood cells in Plasmodium falciparum malaria patients from India.
21545652 2011 Effect of periodontopathogen lipopolysaccharides and proinflammatory cytokines on CD46, CD55, and CD59 gene/protein expression by oral epithelial cells.
21518786 2011 Role of Src kinases in mobilization of glycosylphosphatidylinositol-anchored decay-accelerating factor by Dr fimbria-positive adhering bacteria.
21420451 2011 Development of a recombinant CHO cell model for the investigation of CAR and DAF role during early steps of echovirus 6 infection.
21380985 2011 The role of human decay-accelerating factor in the pathogenesis of preterm labor.
21269460 2011 Initial characterization of the human central proteome.
20727519 2010 Expression of CD55 and CD59 on peripheral blood cells from systemic lupus erythematosus (SLE) patients.
20692039 2010 Binding of human antigen R (HuR) to an AU-rich element (ARE) in the 3'untranslated region (3'UTR) reduces the expression of decay accelerating factor (DAF).
20689133 2010 Quantitation of CD55 and CD59 expression on reticulocytes and mature erythrocytes in paroxysmal nocturnal hemoglobinuria, aplastic anemia, and healthy control subjects.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20638094 2010 Adenovirus 11p downregulates CD46 early in infection.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20339853 2010 The impact of expressions of CD97 and its ligand CD55 at the invasion front on prognosis of rectal adenocarcinoma.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20221634 2011 Role of decay-accelerating factor in regulating survival of human cervical cancer cells.
19878546 2009 Cooperation of decay-accelerating factor and membrane cofactor protein in regulating survival of human cervical cancer cells.
19781296 2009 Decreased expression of complement regulatory proteins, CD55 and CD59, on peripheral blood leucocytes in patients with type 2 diabetes and macrovascular diseases.
19729796 2009 Investigation of CBS, MTR, RFC-1 and TC polymorphisms as maternal risk factors for Down syndrome.
19710132 2009 Dynamin- and lipid raft-dependent entry of decay-accelerating factor (DAF)-binding and non-DAF-binding coxsackieviruses into nonpolarized cells.
19681921 2009 Associations between decay-accelerating factor polymorphisms and allergic respiratory diseases.
19675582 2010 A functional SNP in the regulatory region of the decay-accelerating factor gene associates with extraocular muscle pareses in myasthenia gravis.
19662541 2010 Expression of complement regulatory proteins: CD46, CD55, and CD59 and response to rituximab in patients with CD20+ non-Hodgkin's lymphoma.
19424617 2009 Neutralization of complement regulatory proteins CD55 and CD59 augments therapeutic effect of herceptin against lung carcinoma cells.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19364072 2008 Isolating human islets of Langerhans causes loss of decay accelerating factor (CD55) on beta-cells.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19341386 2009 Preterm labor: CD55 in maternal blood leukocytes.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18997004 2009 Widespread balancing selection and pathogen-driven selection at blood group antigen genes.
18954403 2009 Expression levels of CD47, CD35, CD55, and CD59 on red blood cells and signal-regulatory protein-alpha,beta on monocytes from patients with warm autoimmune hemolytic anemia.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18676748 2008 Prognostic significance of CD55 expression in breast cancer.
18579524 2008 Regulation of the Helicobacter pylori cellular receptor decay-accelerating factor.
18524812 2008 Expression of immunomodulatory genes, their protein products and specific ligands/receptors during the window of implantation in the human endometrium.
18443552 2008 Reduction of CD55 and/or CD59 in red blood cells of patients with HIV infection.
18374870 2008 Decay-accelerating factor expression may provide immunoprotection against antibody-mediated cardiac allograft rejection.
18305044 2008 Hantavirus causing hemorrhagic fever with renal syndrome enters from the apical surface and requires decay-accelerating factor (DAF/CD55).
18165780 2007 Reduced fibrin deposition and intravascular thrombosis in hDAF transgenic pig hearts perfused with tirofiban.
18158579 2008 Detection of CD55- and CD59-deficient granulocytic populations in patients with myelodysplastic syndrome.
17893077 2007 FragAnchor: a large-scale predictor of glycosylphosphatidylinositol anchors in eukaryote protein sequences by qualitative scoring.
17804498 2007 Interaction of decay-accelerating factor with coxsackievirus B3.
17449467 2007 Structural and functional characterization of a novel T cell receptor co-regulatory protein complex, CD97-CD55.
17395591 2007 Structure-based mapping of DAF active site residues that accelerate the decay of C3 convertases.
17368771 2007 The decay accelerating factor mutation I197V found in hemolytic uraemic syndrome does not impair complement regulation.
17182573 2007 Decay-accelerating factor must bind both components of the complement alternative pathway C3 convertase to mediate efficient decay.
17167176 2006 The expression and action of decay-accelerating factor (CD55) in human malignancies and cancer therapy.
16980062 2006 The hDAF exogene protects swine endothelial and peripheral blood mononuclear cells from xenoreactive antibody mediated cytotoxicity in hDAF transgenic pigs.
16951684 2006 Cholesterol glucosylation promotes immune evasion by Helicobacter pylori.
16908271 CD55 and CD59 deficiency in transplant patient populations: possible association with paroxysmal nocturnal hemoglobinuria-like symptoms in Campath-treated patients.
16818763 2006 Costimulation via CD55 on human CD4+ T cells mediated by CD97.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16647457 2006 Fluorescent microspheres reveal different regional blood flow in hyperacutely rejected nontransgenic and hDAF pig hearts.
16626483 2006 Discovery, linkage disequilibrium and association analyses of polymorphisms of the immune complement inhibitor, decay-accelerating factor gene (DAF/CD55) in type 1 diabetes.
16602701 2006 Modification-specific proteomics of plasma membrane proteins: identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment.
16563273 2005 [The effect of atorvastatin on the expression of CD55, CD59 in patients with hyperlipidemia].
16543227 2006 The role of decay-accelerating factor as a receptor for Helicobacter pylori and a mediator of gastric inflammation.
16533428 2006 Inhibition of decay-accelerating factor (CD55) attenuates prostate cancer growth and survival in vivo.
16503113 2006 Molecular cloning and characterization of novel splicing variants of human decay-accelerating factor.
16367924 2006 Blockade of bulky lymphoma-associated CD55 expression by RNA interference overcomes resistance to complement-dependent cytotoxicity with rituximab.
16273233 2005 The expression of CD97EGF and its ligand CD55 on marginal epithelium is related to higher stage and depth of tumor invasion of gastric carcinomas.
16179371 2006 Minor population of CD55-CD59- blood cells predicts response to immunosuppressive therapy and prognosis in patients with aplastic anemia.
16079188 2005 A role for proteinase-activated receptor 2 and PKC-epsilon in thrombin-mediated induction of decay-accelerating factor on human endothelial cells.
15919505 2005 Use of echocardiography to assess function of hDAF-transgenic pig cardiac xenografts.
15907827 2005 Effect of glycosylphosphatidylinositol specific phospholipase D gene expression levels on complement mediated killing of leukemic cells in patients with chronic myeloid leukemia.
15831949 2005 More recent swine vesicular disease virus isolates retain binding to coxsackie-adenovirus receptor, but have lost the ability to bind human decay-accelerating factor (CD55).
15808692 The serum level of xenoantibodies, and hDAF or alphaGAL expression on pig cells, modulate in vitro the protection given by hDAF to primate complement-mediated damage.
15808686 Combining the hDAF transgene with the GP IIb/IIIa inhibitor tirofiban improves heart performance and reduces myocardial damage following hyperacute rejection in an ex vivo perfusion model.
15808683 Combination of hDAF-transgenic pig hearts and immunoadsorption in heterotopic xenotransplantation of immunosuppressed baboons.
15808680 Mean xenograft survival of 14.6 days in a small group of hDAF-transgenic pig hearts transplanted orthotopically into baboons.
15721309 2005 Selective expression of a splice variant of decay-accelerating factor in c-erbB-2-positive mammary carcinoma cells showing increased transendothelial invasiveness.
15710649 2005 The complement inhibitory protein DAF (CD55) suppresses T cell immunity in vivo.
15596863 2005 Interaction with coxsackievirus and adenovirus receptor, but not with decay-accelerating factor (DAF), induces A-particle formation in a DAF-binding coxsackievirus B3 isolate.
15536079 2005 Molecular dissection of interactions between components of the alternative pathway of complement and decay accelerating factor (CD55).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385816 2004 Transgenic expression in pig hearts of both human decay-accelerating factor and human membrane cofactor protein does not provide an additional benefit to that of human decay-accelerating factor alone in pig-to-baboon xenotransplantation.
15356143 2004 Delta-short consensus repeat 4-decay accelerating factor (DAF: CD55) inhibits complement-mediated cytolysis but not NK cell-mediated cytolysis.
15351205 2004 Analysis of the interaction between respiratory syncytial virus and lipid-rafts in Hep2 cells during infection.
15350460 Xenotransplantation of human decay accelerating factor transgenic porcine kidney to non-human primates: 4 years experience at a Canadian center.
15284224 2004 Decay-accelerating factor induction on vascular endothelium by vascular endothelial growth factor (VEGF) is mediated via a VEGF receptor-2 (VEGF-R2)- and protein kinase C-alpha/epsilon (PKCalpha/epsilon)-dependent cytoprotective signaling pathway and is inhibited by cyclosporin A.
15151618 2004 Complement regulatory proteins in normal human esophagus and esophageal squamous cell carcinoma.
15102803 2004 Epithelial invasion by Escherichia coli bearing Dr fimbriae is controlled by nitric oxide-regulated expression of CD55.
15102687 2004 Loss of CD55 is associated with aggressive breast tumors.
15007307 2004 Difference in Ulex europaeus agglutinin I-binding activity of decay-accelerating factor detected in the stools of patients with colorectal cancer and ulcerative colitis.
15007304 2004 Increased serum concentrations and surface expression on peripheral white blood cells of decay-accelerating factor (CD55) in patients with active ulcerative colitis.
14993659 2004 Interactions of decay-accelerating factor (DAF) with haemagglutinating human enteroviruses: utilizing variation in primate DAF to map virus binding sites.
14962294 2004 Complement regulatory proteins are expressed at low levels in embryonic human, wild type and transgenic porcine neural tissue.
14734808 2004 Complement regulation at the molecular level: the structure of decay-accelerating factor.
14722298 2004 Enterovirus capsid interactions with decay-accelerating factor mediate lytic cell infection.
14530374 2003 Antiadhesive role of apical decay-accelerating factor (CD55) in human neutrophil transmigration across mucosal epithelia.
14517339 2003 Proteomic analysis of glycosylphosphatidylinositol-anchored membrane proteins.
12950987 2003 Cellular participation in delayed xenograft rejection of hCD55 transgenic pig hearts by baboons.
12920584 2004 Virus-receptor interactions of coxsackie B viruses and their putative influence on cardiotropism.
12880676 2003 Deficiency of red cell bound CD55 and CD59 in patients with systemic lupus erythematosus.
12811528 2003 Enhanced expression of the complement regulatory protein CD55 predicts a poor prognosis in colorectal cancer patients.
12731067 2003 CD55/decay accelerating factor is part of the lipopolysaccharide-induced receptor complex.
12675719 2003 GUTI: a new antigen in the Cromer blood group system.
12672958 2003 Solution structure of a functionally active fragment of decay-accelerating factor.
12664211 2003 Human decay-accelerating factor expressed on rat hearts inhibits leukocyte adhesion.
12659837 2003 On the same cell type GPI-anchored normal cellular prion and DAF protein exhibit different biological properties.
12654791 2003 Afa/Dr diffusely adhering Escherichia coli infection in T84 cell monolayers induces increased neutrophil transepithelial migration, which in turn promotes cytokine-dependent upregulation of decay-accelerating factor (CD55), the receptor for Afa/Dr adhesins.
12645951 2003 Antigen-presenting cell exosomes are protected from complement-mediated lysis by expression of CD55 and CD59.
12499389 2003 Mapping CD55 function. The structure of two pathogen-binding domains at 1.7 A.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445304 2002 The role of CD55 in protecting the tumour environment from complement attack.
12417565 2002 Markedly enhanced susceptibility to experimental autoimmune myasthenia gravis in the absence of decay-accelerating factor protection.
12409401 2002 Human rhinovirus 87 and enterovirus 68 represent a unique serotype with rhinovirus and enterovirus features.
12393518 2002 Complement-mediated clearance of erythrocytes: mechanism and delineation of the regulatory roles of Crry and DAF. Decay-accelerating factor.
12386146 2002 Statin-induced expression of decay-accelerating factor protects vascular endothelium against complement-mediated injury.
12186929 2002 Interaction with decay-accelerating factor facilitates coxsackievirus B infection of polarized epithelial cells.
12153048 2002 Resonance assignments of the central complement control protein module pair of human decay accelerating factor.
12119400 2002 Structure of decay-accelerating factor bound to echovirus 7: a virus-receptor complex.
12117960 2002 Structure-function analysis of decay-accelerating factor: identification of residues important for binding of the Escherichia coli Dr adhesin and complement regulation.
11983016 2002 Production and characterization of a pig line transgenic for human membrane cofactor protein.
11832343 2002 bFGF and VEGF synergistically enhance endothelial cytoprotection via decay-accelerating factor induction.
11745332 2001 Lipopolysaccharide and ceramide docking to CD14 provokes ligand-specific receptor clustering in rafts.
11694537 2002 Decay-accelerating factor (DAF), complement receptor 1 (CR1), and factor H dissociate the complement AP C3 convertase (C3bBb) via sites on the type A domain of Bb.
11313396 2001 CD24 induces apoptosis in human B cells via the glycolipid-enriched membrane domains/rafts-mediated signaling system.
10540231 1999 Structural characterization of mouse CD97 and study of its specific interaction with the murine decay-accelerating factor (DAF, CD55).
9541601 1998 Decay-accelerating factor is a component of subendothelial extracellular matrix in vitro, and is augmented by activation of endothelial protein kinase C.
9435343 1998 A new repetitive sequence uniquely present in the decay-accelerating factor genes.
9427725 1998 Molecular cloning and characterization of decay-accelerating factor deficiency in Cromer blood group Inab phenotype.
9238658 1996 Complement-binding proteins are strongly expressed by human preimplantation blastocysts and cumulus cells as well as gametes.
9151867 1997 Coxsackievirus A21 binds to decay-accelerating factor but requires intercellular adhesion molecule 1 for cell entry.
9110174 1997 Large-scale concatenation cDNA sequencing.
9064337 1996 The seven-span transmembrane receptor CD97 has a cellular ligand (CD55, DAF).
9010927 1996 Molecular modeling and mechanism of action of human decay-accelerating factor.
8837357 1996 Disappearance of antibodies to Cromer blood group system antigens during mid pregnancy.
8764022 1996 The HeLa cell receptor for enterovirus 70 is decay-accelerating factor (CD55).
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8223854 1993 Activation of human monocytes and granulocytes by monoclonal antibodies to glycosylphosphatidylinositol-anchored antigens.
7687624 1993 Expression of decay-accelerating factor (CD55) of the complement system on human spermatozoa.
7678074 1993 Expression of messenger RNAs for complement inhibitors in human tissues and tumors.
7673728 1995 Differential expression of complement receptors on human basophils and mast cells. Evidence for mast cell heterogeneity and CD88/C5aR expression on skin mast cells.
7545711 1995 Molecular cloning and chromosomal localization of the mouse decay-accelerating factor genes. Duplicated genes encode glycosylphosphatidylinositol-anchored and transmembrane forms.
7538177 1995 Coxsackieviruses B1, B3, and B5 use decay accelerating factor as a receptor for cell attachment.
7525274 1994 Decay-accelerating factor CD55 is identified as the receptor for echovirus 7 using CELICS, a rapid immuno-focal cloning method.
7519480 1994 Molecular basis of reduced or absent expression of decay-accelerating factor in Cromer blood group phenotypes.
7517044 1994 Decay-accelerating factor (CD55), a glycosylphosphatidylinositol-anchored complement regulatory protein, is a receptor for several echoviruses.
7512501 1994 Release of GPI-anchored membrane proteins by a cell-associated GPI-specific phospholipase D.
6211481 1982 Isolation of a human erythrocyte membrane glycoprotein with decay-accelerating activity for C3 convertases of the complement system.
2459267 1988 Decay-accelerating factor in human skin is associated with elastic fibers.
2438369 1987 The gene encoding decay-accelerating factor (DAF) is located in the complement-regulatory locus on the long arm of chromosome 1.
2436222 1987 Cloning and characterization of cDNAs encoding the complete sequence of decay-accelerating factor of human complement.
2433596 1987 Cloning of decay-accelerating factor suggests novel use of splicing to generate two proteins.
2428813 1986 Improved method for the isolation and preliminary characterization of human DAF (decay-accelerating factor).
1824699 1991 Glycophospholipid membrane anchor attachment. Molecular analysis of the cleavage/attachment site.
1740338 1992 Analysis of the human regulators of complement activation (RCA) gene cluster with yeast artificial chromosomes (YACs).
1720702 1991 Biochemical studies on red blood cells from a patient with the Inab phenotype (decay-accelerating factor deficiency).
1712233 1991 Isolation of two forms of decay-accelerating factor (DAF) from human urine.
1711208 1991 Characterization of the decay-accelerating factor gene promoter region.
1385527 1992 Signal transduction through decay-accelerating factor. Interaction of glycosyl-phosphatidylinositol anchor and protein tyrosine kinases p56lck and p59fyn 1.
1377029 1992 Complete determination of disulfide bonds localized within the short consensus repeat units of decay accelerating factor (CD55 antigen).
1376264 1992 Complement regulatory proteins at the feto-maternal interface during human placental development: distribution of CD59 by comparison with membrane cofactor protein (CD46) and decay accelerating factor (CD55).