Property Summary

NCBI Gene PubMed Count 51
PubMed Score 359.48
PubTator Score 151.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
hepatocellular carcinoma 1.200 3.6e-05
Multiple myeloma 2.123 1.2e-03
cutaneous lupus erythematosus 3.400 1.1e-04
psoriasis 1.300 1.4e-03
osteosarcoma -1.909 1.3e-02
glioblastoma 1.700 4.4e-03
non-small cell lung cancer -1.189 1.2e-08
intraductal papillary-mucinous carcinoma... -1.300 3.2e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.7e-02
lung cancer -3.400 6.7e-05
sarcoidosis 1.700 1.3e-02
interstitial cystitis 1.700 1.9e-02
pediatric high grade glioma 1.100 4.2e-04
pilocytic astrocytoma 1.100 4.2e-06
primary Sjogren syndrome 2.900 5.0e-05
subependymal giant cell astrocytoma 1.834 1.6e-02
invasive ductal carcinoma 1.243 2.0e-02
lung carcinoma -1.700 8.5e-18
ulcerative colitis 2.000 8.2e-05
ovarian cancer -1.700 9.9e-08

 GO Function (1)

Gene RIF (27)

PMID Text
26926492 CD48 expression was increased in patients with a short disease duration compared to both controls and patients with longer disease duration. In patients with short disease duration, increased CD48 expression was associated with alveolar inflammation.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD48 (SLAMF2)
25255823 These data demonstrate the important role of CD48 in SA/exotoxins-eosinophil activating interactions that can take place during allergic responses and indicate CD48 as a novel therapeutic target for allergy and especially of AD.
24670806 we propose that SLAMF2 engagement regulates adaptive immune responses
24505299 Blockade of 2B4/CD48 interaction resulted in improvement in function via perforin expression and degranulation as measured by CD107a surface mobilization on HTLV-1 specific CD8+ T cells.
23225218 Monocyte-induced natural killer cell dysfunction was markedly attenuated by blocking CD48 receptor 2B4 on NK cells, but not by blockade of NKG2D and NKp30.
22495247 replication study of association of 2 SNPs in HERV-K18 and 19 tagSNPs in CD48 with schizophrenia (SZ)and type 2 diabetes (T2D) in patients with SZ in 2 Danish samples; no association was found with SZ or with T2D among individuals with SZ for any of the SNPs
20833258 Stimulation of CD48 induces rearrangement of signaling factors in lipid rafts, Lck-kinase activity, and tyrosine phosphorylation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20164429 The ligand (CD48) of the 2B4 receptor can exert both activating and inhibiting signals; natural killer (NK) cells might be at risk for self-killing were it not for the inhibiting signals generated by the 2B4-CD48 interaction.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19494291 CD2 functions as the master switch recruiting CD48 and Lck
18617371 Observational study of gene-disease association. (HuGE Navigator)
17599905 the mechanism of signal transduction by CD244 is to regulate FYN kinase recruitment and/or activity and the outcome of CD48/CD244 interactions is determined by which other receptors are engaged.
17222190 findings indicate that FimH induces host cell signalling cascades that are involved in E. coli K1 invasion of human brain microvascular endothelial cells (HBMEC) and CD48 is a putative HBMEC receptor for FimH
16866884 Observational study of gene-disease association. (HuGE Navigator)
16866884 In conclusion, we cannot confirm a role of human endogenous retrovirus-K18 superantigen polymorphisms or of the CD48 CA repeat for type 1 diabetes susceptibility.
16803907 CD48 is a CD2 and CD244 (2B4)-binding protein
16785501 CD48 is an interleukin (IL)-3-induced activating receptor on eosinophils and may be involved in promoting allergic inflammation.
16585556 2B4 (CD244) can stimulate NK cell cytotoxicity and cytokine production by interacting with NK cell expressed CD48 and adds CD48 to the growing number of activating NK cell receptors
16081768 Review of recent studies suggests an important role for interactions between 2B4 and CD48 in the course of T cell activation and proliferation
15760905 IL-18, IL-18 receptor alpha, and CD48 complex formation via glycosylphosphatidylinositol anchor glycan triggers binding to IL-18 receptor beta, and thereby induces intracellular signal transduction and IFN-gamma production.
15356144 Engagement of natural killer (NK) cell receptor 2B4 by its counterreceptor, CD48, expressed on target cells leads to an inhibition in NK cytotoxicity independent of signaling lymphocytic activation molecule-associated protein (SAP) expression.
12496412 Signal-dependent adhesion of resting NK cells initiated by expression of ICAM-1 is greatly enhanced by coexpression of CD48, even in the absence of cytokines.
12072193 CM1-induced apoptosis is achieved via different initiation pathways, which are cell-type dependent

AA Sequence

MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWD      1 - 70
SRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEK     71 - 140
IEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVC    141 - 210
LSPPCTLARSFGVEWIASWLVVTVPTILGLLLT                                         211 - 243
//

Text Mined References (52)

PMID Year Title
26926492 2016 CD81 and CD48 show different expression on blood eosinophils in systemic sclerosis: new markers for disease and pulmonary inflammation?
25255823 2014 The CD48 receptor mediates Staphylococcus aureus human and murine eosinophil activation.
24670806 2014 Engagement of SLAMF2/CD48 prolongs the time frame of effective T cell activation by supporting mature dendritic cell survival.
24505299 2014 HTLV-1 specific CD8+ T cell function augmented by blockade of 2B4/CD48 interaction in HTLV-1 infection.
23225218 2013 Monocyte/macrophage-elicited natural killer cell dysfunction in hepatocellular carcinoma is mediated by CD48/2B4 interactions.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22495247 2012 No association of polymorphisms in human endogenous retrovirus K18 and CD48 with schizophrenia.
20833258 2011 CD48: A co-stimulatory receptor of immunity.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20164429 2010 The association of MHC class I proteins with the 2B4 receptor inhibits self-killing of human NK cells.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19494291 2009 Sequential cooperation of CD2 and CD48 in the buildup of the early TCR signalosome.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
18617371 2008 Polymorphisms in human endogenous retrovirus K-18 and risk of type 2 diabetes in individuals with schizophrenia.
18296487 2008 Large-scale screening for novel low-affinity extracellular protein interactions.
17599905 2007 Direct and indirect interactions of the cytoplasmic region of CD244 (2B4) in mice and humans with FYN kinase.
17222190 2007 FimH-mediated Escherichia coli K1 invasion of human brain microvascular endothelial cells.
16866884 2006 Neither an intronic CA repeat within the CD48 gene nor the HERV-K18 polymorphisms are associated with type 1 diabetes.
16803907 2006 Crystal structure and binding properties of the CD2 and CD244 (2B4)-binding protein, CD48.
16785501 2006 CD48 is an allergen and IL-3-induced activation molecule on eosinophils.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16585556 2006 CD48 stimulation by 2B4 (CD244)-expressing targets activates human NK cells.
16081768 2005 2B4/CD48-mediated regulation of lymphocyte activation and function.
16002700 2005 Mutational analysis of the human 2B4 (CD244)/CD48 interaction: Lys68 and Glu70 in the V domain of 2B4 are critical for CD48 binding and functional activation of NK cells.
15760905 2005 Functional role played by the glycosylphosphatidylinositol anchor glycan of CD48 in interleukin-18-induced interferon-gamma production.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356144 2004 The murine NK receptor 2B4 (CD244) exhibits inhibitory function independent of signaling lymphocytic activation molecule-associated protein expression.
12496412 2003 Coexpression of CD58 or CD48 with intercellular adhesion molecule 1 on target cells enhances adhesion of resting NK cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356317 2002 Direct measurements of heterotypic adhesion between the cell surface proteins CD2 and CD48.
12072193 2002 CM1 ligation initiates apoptosis in a caspase 8-dependent manner in Ramos cells and in a mitochondria-controlled manner in Raji cells.
12007789 2002 The oxygen-substituted palmitic acid analogue, 13-oxypalmitic acid, inhibits Lck localization to lipid rafts and T cell signaling.
11513145 2001 2B4 (CD244) and CS1: novel members of the CD2 subset of the immunoglobulin superfamily molecules expressed on natural killer cells and other leukocytes.
11313396 2001 CD24 induces apoptosis in human B cells via the glycolipid-enriched membrane domains/rafts-mediated signaling system.
11313125 2001 Glycosylphosphatidylinositol-anchored receptor-mediated bacterial endocytosis.
11163399 2000 2B4-mediated activation of human natural killer cells.
10359122 1999 Activating interactions in human NK cell recognition: the role of 2B4-CD48.
9834056 1998 Identification of the 2B4 molecule as a counter-receptor for CD48.
9418191 1997 Detection of a soluble form of the leukocyte surface antigen CD48 in plasma and its elevation in patients with lymphoid leukemias and arthritis.
8650218 1996 The association between glycosylphosphatidylinositol-anchored proteins and heterotrimeric G protein alpha subunits in lymphocytes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8104794 1993 The association of the protein tyrosine kinases p56lck and p60fyn with the glycosyl phosphatidylinositol-anchored proteins Thy-1 and CD48 in rat thymocytes is dependent on the state of cellular activation.
2828034 1987 Molecular cloning of the lymphocyte activation marker Blast-1.
1999351 1991 The isolation of cDNA clones for CD48.
1999350 1991 The human leucocyte antigen CD48 (MEM-102) is closely related to the activation marker Blast-1.
1847502 1991 Characterization of the Epstein-Barr virus-inducible gene encoding the human leukocyte adhesion and activation antigen BLAST-1 (CD48).
1827826 1991 TCT.1, a target molecule for gamma/delta T cells, is encoded by an immunoglobulin superfamily gene (Blast-1) located in the CD1 region of human chromosome 1.
1693656 1990 Structure, expression, and genetic linkage of the mouse BCM1 (OX45 or Blast-1) antigen. Evidence for genetic duplication giving rise to the BCM1 region on mouse chromosome 1 and the CD2/LFA3 region on mouse chromosome 3.