Property Summary

NCBI Gene PubMed Count 138
PubMed Score 506.00
PubTator Score 335.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (34)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.377 1.6e-02
Multiple myeloma 2.760 8.8e-06
malignant mesothelioma -1.700 2.8e-07
astrocytic glioma -1.400 3.8e-02
ependymoma -2.000 3.5e-02
oligodendroglioma -1.300 4.5e-02
psoriasis 1.900 3.1e-18
osteosarcoma 1.935 8.5e-06
medulloblastoma -1.800 2.0e-05
cystic fibrosis 1.478 7.5e-06
glioblastoma 2.500 2.9e-04
atypical teratoid / rhabdoid tumor -3.400 8.9e-07
medulloblastoma, large-cell -2.200 2.5e-04
primitive neuroectodermal tumor -1.300 5.2e-06
juvenile dermatomyositis 1.881 6.4e-16
Duchenne muscular dystrophy 1.425 6.8e-06
autosomal dominant Emery-Dreifuss muscul... 1.109 7.9e-03
Atopic dermatitis 1.300 1.8e-05
pancreatic ductal adenocarcinoma liver m... 1.724 1.5e-02
non-small cell lung cancer -1.764 3.0e-19
intraductal papillary-mucinous adenoma (... 1.400 8.8e-03
intraductal papillary-mucinous carcinoma... 1.300 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.900 1.2e-02
lung cancer -2.000 7.6e-05
pancreatic cancer 1.600 2.1e-04
adult high grade glioma -1.500 2.3e-04
primary Sjogren syndrome 1.300 3.2e-03
lung adenocarcinoma -1.200 4.7e-06
Pick disease -1.200 9.8e-03
Breast cancer -1.700 9.1e-12
invasive ductal carcinoma -1.100 1.7e-02
ulcerative colitis 1.100 2.2e-07
ovarian cancer 3.700 1.8e-06
dermatomyositis 2.100 1.8e-03

Protein-protein Interaction (10)

Gene RIF (108)

PMID Text
27437576 atherogenesis is associated with upregulation of CD47, a key anti-phagocytic molecule that is known to render malignant cells resistant to programmed cell removal, or 'efferocytosis'
26573233 Data suggest a reduction in the CD47 antigen/signal-regulatory protein alpha (SIRPalpha) pathway by programmed cell death protein 1 (PD-1) blockade, which regulates Myeloid-derived suppressor cells (MDSCs) and tumor associated macrophages (TAMs).
26512116 CD47 expression contributes to the lethal breast cancer phenotype that is mediated by HIF-1.
26311851 CD47 mediates signaling from the extracellular matrix that coordinately regulates basal metabolism and cytoprotective responses to radiation injury
26116271 agents that block the CD47:SIRP-alpha engagement are attractive therapeutic targets as a monotherapy or in combination with additional immune-modulating agents for activating antitumor T cells in vivo
26093091 CD47 is a critical regulator in the metastasis of osteosarcoma and results suggest that targeted inhibition of this antigen by anti-CD47 may be a novel immunotherapeutic approach in the management of this tumor.
26085683 Loss of cell surface CD47 clustering formation and binding avidity to SIRPalpha facilitate apoptotic cell clearance by macrophages.
26077800 CD47 is an adverse prognostic factor and promising therapeutic target in gastric cancer.
25943033 While CD47 expression on circulating AML blasts has been shown to be a negative prognostic marker for a very defined population of AML patients with NK AML, CD47 expression on AML BM blasts is not
25896326 during translation of CD47, the scaffold function of the 3' UTR facilitates binding of proteins to nascent proteins, to direct their transport or function--and this role of 3' UTRs can be regulated by polyadenylation
25837251 Velcro" engineering of high affinity CD47 ectodomain as signal regulatory protein alpha (SIRPalpha) antagonists that enhance antibody-dependent cellular phagocytosis
25747479 CD47 has a central role in hydrogen sulfate biosynthesis, regulation and signaling in T cells.
25717063 CD47 is highly expressed on cancer stem cells, but not on other nonmalignant cells in the pancreas.
25658794 Expression of CD44, CD47 and c-met was upregulated in OCCC and pairwise correlation. CD44, CD47 and c-met may have synergistic effects on the development of OCCC and are prognostic factors for ovarian cancer.
25593301 study demonstrates that antigen-presenting cells(CD47+) in coculture with human macrophages show a CD47 concentration-dependent inhibition of phagocytosis
25550546 CD47 regulates the epigenetic code by targeting UHRF1.
25230070 Report poor prognosis/survival in luminal breast cancer patients with circulating tumor cells co-expressing MET and CD47.
25200950 CD47 associates with and regulates VEGFR2 in T cells. CD47 signaling modulates the ability of VEGF to regulate proliferation and TCR signaling, and autocrine production of vascular endothelial growth factor by T cells contributes to this regulation.
25001859 Elevated postinjury thrombospondin 1-CD47 triggering aids differentiation of patients' defective inflammatory CD1a+dendritic cells.
24911792 expression is induced following EBV infection of B cells; ligation cases G1 arres
24887393 The thrombospondin-1 receptor CD47 directly or indirectly regulates intercellular communication mediated by the transfer of extracellular vesicles between vascular cells.
24848268 the TSP-derived 4N1K peptide effects on cell adhesion and integrin activation are independent of CD47
24840181 Staphylococcal SElX and SSL6 proteins bind cell surface receptors PSGL-1 and CD47, respectively.
24726056 CD47 plays the pivotal role in the immune evasion of primary effusion lymphoma cells in body cavities. Therapeutic antibody targeting of CD47 could be an effective therapy for PEL.
24631171 CD24/CD44/CD47 are differentially expressed in cells of urothelial BCa in patients undergoing RC and influence cancer-specific survival of patients
24550402 Polymorphisms in the human inhibitory signal-regulatory protein alpha do not affect binding to its ligand CD47.
24523067 Suppression of CD47 by morpholino approach suppressed growth of hepatocellular carcinoma in vivo and exerted a chemosensitization effect through blockade of CTSS/PAR2 signaling.
24269920 Studies suggest that the mouse strain effect on xenogeneic engraftment might be ascribed mainly to the binding affinity of strain-specific polymorphic SIRPA with human CD47.
24143245 'clustering' SIRPalpha into plasma membrane microdomains is essential for activated monocytes and macrophages to effectively interact with CD47 and initiate intracellular signaling
24006483 Data indicate that CD47 in cis interactions regulate LFA-1 (integrin alphaLbeta2) and VLA-4 (integrin alpha4beta1) integrin affinity, and this process plays a substantial role in the adhesion of T-cells.
23774794 Findings indicate CD47 as a potential prognostic marker for melanoma development as well as a target for therapeutic intervention with RNAi-based nanomedicines.
23690610 Anti-CD47 antibody-mediated phagocytosis of cancer cells by macrophages results in increased priming of transgenic CD8+ OT-I T cells but decreased priming of CD4+ OT-II T cells.
23669395 An avidity-improved CD47 fusion protein (CD47-Var1) suppresses the release of a wide array of inflammatory cytokines by CD172a(+) cells.
23642736 Data indicate that the level of CD47 on erythroblast of myelodysplastic syndrome (MDS) patients had a significant positive correlation with their peripheral RBC count.
23275336 Inhibitor of apoptosis proteins (IAPs) and their antagonists regulate spontaneous and tumor necrosis factor (TNF)-induced proinflammatory cytokine and chemokine production
23206327 This study analysis revealed up-regulation of CD14, CD18, CD45, TLR2, TLR4, CD74, C1q, C3, CCL2, and down-regulation of CD36, CX3CR1, CX3CL1 and CD200 in postmenopausal women.
23011546 The eSNP (single nucleotide polymorphism associated with expression) rs12695175 in CD47 associated with CRC specific survival (HR = 2.18, 95 % CI 1.10-4.33, CC versus AA) and with overall survival.
22990013 Engulfment of hematopoietic stem cells caused by down-regulation of CD47 is critical in the pathogenesis of hemophagocytic lymphohistiocytosis.
22874555 CD47 deficiency confers cell survival through the activation of autophagic flux and identifies CD47 blockade as a pharmacological route to modulate autophagy for protecting tissue from radiation injury.
22870271 CD47(low) status on CD4 effectors is necessary for the contraction/resolution of the immune response in humans and mice.
22815286 Both human endothelial and leukocyte CD47 are required for T cell transendothelial migration at sites of inflammation.
22734047 Data show that CD47 is expressed in normal myelin and in foamy macrophages and reactive astrocytes within active multiple sclerosis (MS)lesions.
22641236 CD47 expression is a novel prognostic marker in esophageal squamous cell carcinoma that is directly inhibited by the miR-133a tumor suppressor.
22535707 ectopic expression of murine Cd47 in human hepatocytes selectively favors engraftment upon transplantation into mice, a finding that should have a profound impact on the generation of robust humanized small animal models.
22511785 Surfactant protein D (Sp-D) binds to membrane-proximal domain (D3) of signal regulatory protein alpha (SIRPalpha), a site distant from binding domain of CD47, while also binding to analogous region on signal regulatory protein beta (SIRPbeta).
22451913 data,show that CD47 is a commonly expressed molecule on all cancers, its function to block phagocytosis is known, and blockade of its function leads to tumor cell phagocytosis and elimination
22427202 CD47 on experimentally aged erythrocytes is recognized by SIRPalpha.
22215724 Activated CD47 promotes pulmonary arterial hypertension through targeting caveolin-1.
22079249 a specific and age-dependent interaction of soluble fibrinogen with human RBC membrane; additionally we present CD47 as a putative mediator in this process. This interaction may contribute to RBC hyperaggregation in inflammation.
22014686 vitamin D binding protein does not bind to TSP-1, CD36 or CD47
21343308 inhibition of T cell receptor signaling by thrombospondin-1 is mediated by CD47 and requires its modification at Ser(64).
21211546 Results demonstrate that the CD47 pathway in ITP patients abnormally modulates platelet homeostasis.
21203512 Amyloid-beta inhibits No-cGMP signaling in a CD36- and CD47-dependent manner
21178137 Increased CD47 expression correlated with high amounts of calreticulin on cancer cells and was necessary for protection from calreticulin-mediated phagocytosis.
20923780 Thrombospondin-1 inhibits VEGF receptor-2 signaling by disrupting its association with CD47
20826801 The role of cis dimerization of signal regulatory protein alpha (SIRPalpha) in binding to CD47.
20705613 Poor prognosis of breast cancer patients with high expression of CD47 is due to an active CD47/SIRPA signaling pathway in circulating cells.
20675593 Escherichia coli upregulation of CD47 in dendritic cells (DC) triggers production of DC natural ligand thrombospondin-1 and prevents the cell maturation process.
20364320 CD47 signaling is active within cells of the neurovascular interface.
20299253 Inhibition of engulfment correlates with affinity of CD47 for SIRPA - but only at low levels of CD47.
20033473 Data show that cartilage oligomeric matrix protein (COMP) promotes cell attachment via independent mechanisms involving cell surface CD47 and alphaVbeta3 integrin and that cell attachment to COMP induces formation of fascin-stabilized actin microspikes.
19952055 Our findings suggest that microRNA dysregulated in multiple sclerosis lesions reduce CD47 in brain resident cells, releasing macrophages from inhibitory control, thereby promoting phagocytosis of myelin.
19794081 Reduced levels of CD47 are expected to result in a reduced level of phosphatidylserine exposure following ligation.
19748659 CD47/SIRP-alpha interactions are implicated in the pathogenesis of DC-driven allergic airway inflammation.
19661269 Disruption of CD47-TSP-1 interactions or preventing the recruitment of DCs to tumors may provide novel approaches to therapy of myeloma bone disease and osteoporosis.
19632178 Study concludes that CD47 upregulation is an important mechanism that provides protection to normal HSCs during inflammation-mediated mobilization, and that leukemic progenitors co-opt this ability in order to evade macrophage killing.
19628875 Data show show that the CD47-SIRPalpha interaction will span a distance of around 14 nm between interacting cells, comparable with that of an immunological synapse.
19360900 CD47 signaling can negatively affect the viability and function of cerebral endothelial cells, further supporting the notion that CD47 may be a potential neurovascular target for stroke and brain injury
19144568 expression downregulated in multiple slerosis lesions, suggesting role in CNS inflammation
18979398 Down-regulation of the IAP antagonistis XAF1, Smac/DIABLO and HtrA2, has been related to the onset and progression of various malignancies.
18954403 Expression levels of CD47, CD35, CD55, and CD59 on red blood cells and signal-regulatory protein-alpha,beta on monocytes from patients with warm autoimmune hemolytic anemia.
18855618 In this review, the CD47/thrombospondin-1/signal-regulatory protein (SIRP)-alpha inhibitory axis is proposed as an important sensor to maintain homeostasis and regulate innate and adaptive immune responses.
18675774 TSP-1's C-terminal domain opens to interact with the CD-47 receptor
18657508 These results explain the specificity of CD47 for the SIRP family of paired receptors in atomic detail.
18524990 CD47 is enriched at endothelial junctions, and its interaction with SIRPgamma is required for human T-cell transendothelial migration
18523271 A T cell-negative sensor that may serve to dampen unchecked proinflammatory T helper cell type 1 (Th1) responses, such as occur during contact hypersensitivity in transgenic mice.
18497546 CD47 may play an inhibitory role in NK cell-mediated cytotoxicity against cancer cells, implying a possible mechanism of immune escape in human cancer.
18332220 On both RBCs and microbeads, human CD47 potently inhibits phagocytosis as does direct inhibition of myosin. CD47-SIRPalpha interaction initiates a dephosphorylation cascade directed in part at phosphotyrosine in myosin.
18186923 CD47/IAP is necessary for chondrocyte mechanotransduction. Through interactions with alpha5beta1 integrin and thrombospondin, CD47/IAP may modulate chondrocyte responses to mechanical signals.
17572512 Upregulation of CD47 in sporadic inclusion body myositis.
17363705 In this review the authors provide mechanistic insight into the signaling pathways used by thrombospondin-1 and CD47 at the cellular and molecular level to prevent nitric oxide signaling through cyclic GMP, thereby exacerbating tissue ischemia.
17360380 Genetic induction of human CD47 on porcine cells could provide inhibitory signaling to SIRPalpha on human macrophages, providing a novel approach to preventing macrophage-mediated xenograft rejection.
17098740 analysis of species-specific CD47 interactions with signal regulatory protein alpha
16951312 CD47 stimulation by a thrombospondin-1 peptide induces naive or memory CD4+CD25- T cells to become suppressive.
16697668 highlight major species differences in CD47-SIRPalpha interactions and CD47 integration, suggesting that signaling by CD47 in man may be qualitatively different from mouse.
16581280 RhD co-localizeS with CD47 but not calreticulin or glycophorin-A on human RBCs.
16291597 SIRPalpha-CD47 interactions, which reportedly define self, exhibit cell type specificity and limited cross-species reactivity
15917238 CD47 associates with Fas upon its activation and augments Fas-mediated apoptosis.
15880429 Novel CD47-dependent intercellular adhesion modulates cell movement.
15842360 SHPS-1 negatively regulates platelet function via CD47, especially alpha(IIb)beta(3)-mediated outside-in signaling
15725479 Apoptosis inducing single-chain antibody fragments against cd47 antigens will be effective as a novel therapy for multiple myeloma.
15498560 CD47 short interferint RNA inhibited cell proliferation in cultures of hepatoma cells.
15359629 Review. The interaction between CD47 and SIRPalpha seems to be important to limit destruction of host cells in autoimmune diseases like autoimmune hemolytic anemia (AIHA), where macrophages destroy antibody or complement opsonized cells.
15292185 CD47 has a role in inducing alpha4beta1 integrin activation and adhesion in sickle reticulocytes
14966135 CD47 recruits alpha(v)beta(3) and its associated signaling molecules to these domains
14747477 IAP gene expression is regulated by alpha-Pal
14551146 protein 4.2 strongly influences CD47 levels as well as the extent of membrane skeleton attachment in erythrocytes
12902472 Interaction of CD47 with thrombospondin-1 contributes to the perpetuation of inflammation in rheumatoid synovitis.
12736272 the extracellular Ig domain of IAP(CD47), when bound to thrombospondin, interacts with integrin alphaIIbbeta3 and can change alphaIIbbeta3 in a high affinity state without the requirement of intracellular signaling
12646616 Ligation of CD47 by any of its known ligands rapidly induces heterotrimeric Gi alpha-dependent but caspase-independent apoptosis in Jurkat T cells and, importantly, in activated primary T cells.
12609828 CD47 expressed on platelets significantly contributes to platelet adhesion on tumor necrosis factor-alpha (TNF-alpha)-stimulated vascular endothelial cells
12393467 Evidence protein 4.2 interacts with the Rh membrane complex member CD47 obtained from red cells of patients with hereditary spherocytosis associated with complete protein 4.2 deficiency
12393442 distribution of CD47, most restrained by cytoskeleton linkages plus a smaller fraction able to diffuse in the membrane, and colocalization with Rh protein complexes
12370491 An autocrine loop of the integrin alpha(V)beta(3)/CD47 receptor complex and thrombospondin-1 is identified as the molecular coupling device between mechanical loading and apoptosis.
12351399 mechanism of antigen-induced caspase-independent cell death in normal and leukemic cells
12218055 regulates integrin function. Differential effects on alpha vbeta 3 and alpha 4beta1 integrin-mediated adhesion.
11980922 Interactions of thrombospondins with alpha4beta1 integrin and CD47 differentially modulate T cell behavior
11907074 The interaction of CD47 with SHPS-1 may contribute to the recruitment of B lymphocytes via endothelial cells under steady state conditions.

AA Sequence

MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDG      1 - 70
ALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPN     71 - 140
ENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALLVAGLVITVIVIVGAILFVPGEYSLKNATGL    141 - 210
GLIVTSTGILILLHYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILAL    211 - 280
AQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE                               281 - 323
//

Text Mined References (141)

PMID Year Title
27437576 2016 CD47-blocking antibodies restore phagocytosis and prevent atherosclerosis.
26573233 2015 PD-1 blockade attenuates immunosuppressive myeloid cells due to inhibition of CD47/SIRP? axis in HPV negative head and neck squamous cell carcinoma.
26512116 2015 HIF-1 regulates CD47 expression in breast cancer cells to promote evasion of phagocytosis and maintenance of cancer stem cells.
26311851 2015 CD47 Receptor Globally Regulates Metabolic Pathways That Control Resistance to Ionizing Radiation.
26116271 2015 Molecular Pathways: Activating T Cells after Cancer Cell Phagocytosis from Blockade of CD47 "Don't Eat Me" Signals.
26093091 2015 CD47 blockade inhibits tumor progression human osteosarcoma in xenograft models.
26085683 2015 Loss of Cell Surface CD47 Clustering Formation and Binding Avidity to SIRP? Facilitate Apoptotic Cell Clearance by Macrophages.
26077800 2015 CD47 is an adverse prognostic factor and a therapeutic target in gastric cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25943033 2015 CD47 protein expression in acute myeloid leukemia: A tissue microarray-based analysis.
25896326 2015 Alternative 3' UTRs act as scaffolds to regulate membrane protein localization.
25837251 2015 "Velcro" engineering of high affinity CD47 ectodomain as signal regulatory protein ? (SIRP?) antagonists that enhance antibody-dependent cellular phagocytosis.
25747479 2015 CD47-dependent regulation of H?S biosynthesis and signaling in T cells.
25717063 2015 Inhibition of CD47 Effectively Targets Pancreatic Cancer Stem Cells via Dual Mechanisms.
25658794 2015 Expression and significance of CD44, CD47 and c-met in ovarian clear cell carcinoma.
25593301 2015 CD47 Enhances In Vivo Functionality of Artificial Antigen-Presenting Cells.
25550546 2015 CD47 activation-induced UHRF1 over-expression is associated with silencing of tumor suppressor gene p16INK4A in glioblastoma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25230070 2014 Co-expression of MET and CD47 is a novel prognosticator for survival of luminal breast cancer patients.
25200950 2014 CD47 signaling regulates the immunosuppressive activity of VEGF in T cells.
25001859 2014 Elevated postinjury thrombospondin 1-CD47 triggering aids differentiation of patients' defective inflammatory CD1a+dendritic cells.
24911792 Ligation of CD47 induces G1 arrest in EBV-transformed B cells through ROS generation, p38 MAPK/JNK activation, and Tap73 upregulation.
24887393 2014 CD47-dependent immunomodulatory and angiogenic activities of extracellular vesicles produced by T cells.
24848268 2014 CD47-independent effects mediated by the TSP-derived 4N1K peptide.
24840181 2014 Staphylococcus aureus proteins SSL6 and SElX interact with neutrophil receptors as identified using secretome phage display.
24726056 2014 Efficacy of anti-CD47 antibody-mediated phagocytosis with macrophages against primary effusion lymphoma.
24631171 2014 Expression and prognostic significance of cancer stem cell markers CD24 and CD44 in urothelial bladder cancer xenografts and patients undergoing radical cystectomy.
24550402 2014 Polymorphisms in the human inhibitory signal-regulatory protein ? do not affect binding to its ligand CD47.
24523067 2014 Blockade of CD47-mediated cathepsin S/protease-activated receptor 2 signaling provides a therapeutic target for hepatocellular carcinoma.
24269920 2014 The BALB/c-specific polymorphic SIRPA enhances its affinity for human CD47, inhibiting phagocytosis against human cells to promote xenogeneic engraftment.
24143245 2013 'Clustering' SIRP? into the plasma membrane lipid microdomains is required for activated monocytes and macrophages to mediate effective cell surface interactions with CD47.
24006483 2013 CD47 plays a critical role in T-cell recruitment by regulation of LFA-1 and VLA-4 integrin adhesive functions.
23774794 2013 Intravenous delivery of siRNA targeting CD47 effectively inhibits melanoma tumor growth and lung metastasis.
23690610 2013 Anti-CD47 antibody-mediated phagocytosis of cancer by macrophages primes an effective antitumor T-cell response.
23669395 2013 CD47 fusion protein targets CD172a+ cells in Crohn's disease and dampens the production of IL-1? and TNF.
23642736 2013 CD47 is expressed abnormally on hematopoietic cells in myelodysplastic syndrome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23275336 2013 Inhibitor of apoptosis proteins (IAPs) and their antagonists regulate spontaneous and tumor necrosis factor (TNF)-induced proinflammatory cytokine and chemokine production.
23206327 2012 Menopause leads to elevated expression of macrophage-associated genes in the aging frontal cortex: rat and human studies identify strikingly similar changes.
23011546 2013 Association study identifying polymorphisms in CD47 and other extracellular matrix pathway genes as putative prognostic markers for colorectal cancer.
22990013 2012 Engulfment of hematopoietic stem cells caused by down-regulation of CD47 is critical in the pathogenesis of hemophagocytic lymphohistiocytosis.
22874555 2012 CD47 deficiency confers cell and tissue radioprotection by activation of autophagy.
22870271 2012 CD47(low) status on CD4 effectors is necessary for the contraction/resolution of the immune response in humans and mice.
22815286 2012 Endothelial CD47 promotes vascular endothelial-cadherin tyrosine phosphorylation and participates in T cell recruitment at sites of inflammation in vivo.
22734047 2012 Janus-like opposing roles of CD47 in autoimmune brain inflammation in humans and mice.
22641236 2012 CD47 expression regulated by the miR-133a tumor suppressor is a novel prognostic marker in esophageal squamous cell carcinoma.
22535707 2012 Ectopic expression of murine CD47 minimizes macrophage rejection of human hepatocyte xenografts in immunodeficient mice.
22511785 2012 Surfactant protein D (Sp-D) binds to membrane-proximal domain (D3) of signal regulatory protein ? (SIRP?), a site distant from binding domain of CD47, while also binding to analogous region on signal regulatory protein ? (SIRP?).
22451913 2012 The CD47-signal regulatory protein alpha (SIRPa) interaction is a therapeutic target for human solid tumors.
22427202 2012 CD47 functions as a molecular switch for erythrocyte phagocytosis.
22215724 2012 Activated CD47 promotes pulmonary arterial hypertension through targeting caveolin-1.
22079249 2012 Integrin-associated protein (CD47) is a putative mediator for soluble fibrinogen interaction with human red blood cells membrane.
22014686 2011 Cofactor regulation of C5a chemotactic activity in physiological fluids. Requirement for the vitamin D binding protein, thrombospondin-1 and its receptors.
21343308 2011 Heparan sulfate modification of the transmembrane receptor CD47 is necessary for inhibition of T cell receptor signaling by thrombospondin-1.
21211546 2011 The CD47 pathway is deregulated in human immune thrombocytopenia.
21203512 2010 Amyloid-? inhibits No-cGMP signaling in a CD36- and CD47-dependent manner.
21178137 2010 Calreticulin is the dominant pro-phagocytic signal on multiple human cancers and is counterbalanced by CD47.
20923780 2010 Thrombospondin-1 inhibits VEGF receptor-2 signaling by disrupting its association with CD47.
20826801 2010 The role of cis dimerization of signal regulatory protein alpha (SIRPalpha) in binding to CD47.
20705613 2010 Correlated expression of CD47 and SIRPA in bone marrow and in peripheral blood predicts recurrence in breast cancer patients.
20675593 2010 Escherichia coli K1 promotes the ligation of CD47 with thrombospondin-1 to prevent the maturation of dendritic cells in the pathogenesis of neonatal meningitis.
20364320 2010 Induction of vascular endothelial growth factor and matrix metalloproteinase-9 via CD47 signaling in neurovascular cells.
20299253 2010 Self inhibition of phagocytosis: the affinity of 'marker of self' CD47 for SIRPalpha dictates potency of inhibition but only at low expression levels.
20033473 2010 Cartilage oligomeric matrix protein promotes cell attachment via two independent mechanisms involving CD47 and alphaVbeta3 integrin.
19952055 2009 MicroRNA profiling of multiple sclerosis lesions identifies modulators of the regulatory protein CD47.
19794081 2009 4.1R-deficient human red blood cells have altered phosphatidylserine exposure pathways and are deficient in CD44 and CD47 glycoproteins.
19748659 2009 Selective control of SIRP-alpha-positive airway dendritic cell trafficking through CD47 is critical for the development of T(H)2-mediated allergic inflammation.
19661269 2009 Dominant role of CD47-thrombospondin-1 interactions in myeloma-induced fusion of human dendritic cells: implications for bone disease.
19632178 2009 CD47 is upregulated on circulating hematopoietic stem cells and leukemia cells to avoid phagocytosis.
19628875 2009 Structure of signal-regulatory protein alpha: a link to antigen receptor evolution.
19360900 2009 Neurovascular effects of CD47 signaling: promotion of cell death, inflammation, and suppression of angiogenesis in brain endothelial cells in vitro.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19144568 2009 Neuronal regulation of immune responses in the central nervous system.
18979398 2008 [Expression levels of the IAP antagonists XAF1, Smac/DIABLO and HtrA2 in testicular germ cell tumours].
18954403 2009 Expression levels of CD47, CD35, CD55, and CD59 on red blood cells and signal-regulatory protein-alpha,beta on monocytes from patients with warm autoimmune hemolytic anemia.
18855618 2008 CD47 in the immune response: role of thrombospondin and SIRP-alpha reverse signaling.
18675774 2008 Human thrombospondin's (TSP-1) C-terminal domain opens to interact with the CD-47 receptor: a molecular modeling study.
18657508 2008 Paired receptor specificity explained by structures of signal regulatory proteins alone and complexed with CD47.
18524990 2008 Endothelial CD47 interaction with SIRPgamma is required for human T-cell transendothelial migration under shear flow conditions in vitro.
18523271 2008 CD47 expression on T cell is a self-control negative regulator of type 1 immune response.
18497546 2008 Association of CD47 with natural killer cell-mediated cytotoxicity of head-and-neck squamous cell carcinoma lines.
18332220 2008 Inhibition of "self" engulfment through deactivation of myosin-II at the phagocytic synapse between human cells.
18186923 2008 CD47 associates with alpha 5 integrin and regulates responses of human articular chondrocytes to mechanical stimulation in an in vitro model.
17572512 2007 Upregulation of thrombospondin-1(TSP-1) and its binding partners, CD36 and CD47, in sporadic inclusion body myositis.
17363705 2007 Targeting CD47: NO limit on therapeutic potential.
17360380 2007 Role for CD47-SIRPalpha signaling in xenograft rejection by macrophages.
17098740 2007 Phylogenetic divergence of CD47 interactions with human signal regulatory protein alpha reveals locus of species specificity. Implications for the binding site.
16951312 2006 Thrombospondin/CD47 interaction: a pathway to generate regulatory T cells from human CD4+ CD25- T cells in response to inflammation.
16697668 Membrane mobility and clustering of Integrin Associated Protein (IAP, CD47)--major differences between mouse and man and implications for signaling.
16691243 2006 The SIRP family of receptors and immune regulation.
16581280 The 'metabolon,' CD47, and the 'phagocytic synapse': molecular co-localization and species divergence.
16291597 2006 Species- and cell type-specific interactions between CD47 and human SIRPalpha.
15917238 2005 CD47 augments Fas/CD95-mediated apoptosis.
15880429 2005 Novel CD47-dependent intercellular adhesion modulates cell migration.
15842360 2005 SHPS-1 negatively regulates integrin alphaIIbbeta3 function through CD47 without disturbing FAK phosphorylation.
15725479 2005 Apoptosis inducing bivalent single-chain antibody fragments against CD47 showed antitumor potency for multiple myeloma.
15700281 2005 Insulin-like growth factor binding protein-5 (IGFBP-5) interacts with thrombospondin-1 to induce negative regulatory effects on IGF-I actions.
15498560 2004 The C-terminal 26-residue peptide of serpin A1 stimulates proliferation of breast and liver cancer cells: role of protein kinase C and CD47.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383453 2005 Adhesion of human T cells to antigen-presenting cells through SIRPbeta2-CD47 interaction costimulates T-cell proliferation.
15359629 2004 Role of CD47 in erythroid cells and in autoimmunity.
15292185 2004 Mechanism of CD47-induced alpha4beta1 integrin activation and adhesion in sickle reticulocytes.
14966135 2004 Cholesterol-independent interactions with CD47 enhance alphavbeta3 avidity.
14759258 2004 An unappreciated role for RNA surveillance.
14747477 2004 Alpha-Pal/NRF-1 regulates the promoter of the human integrin-associated protein/CD47 gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14551146 2004 Protein 4.2 is critical to CD47-membrane skeleton attachment in human red cells.
12902472 2003 Synoviocyte-mediated expansion of inflammatory T cells in rheumatoid synovitis is dependent on CD47-thrombospondin 1 interaction.
12736272 2003 Thrombospondin-bound integrin-associated protein (CD47) physically and functionally modifies integrin alphaIIbbeta3 by its extracellular domain.
12690108 2003 CD47 and the 19 kDa interacting protein-3 (BNIP3) in T cell apoptosis.
12646616 2003 The mechanism of CD47-dependent killing of T cells: heterotrimeric Gi-dependent inhibition of protein kinase A.
12609828 2003 Involvement of a CD47-dependent pathway in platelet adhesion on inflamed vascular endothelium under flow.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393467 2003 Evidence that the red cell skeleton protein 4.2 interacts with the Rh membrane complex member CD47.
12393442 2003 Fractional attachment of CD47 (IAP) to the erythrocyte cytoskeleton and visual colocalization with Rh protein complexes.
12370491 2002 Mechanosensitive induction of apoptosis in fibroblasts is regulated by thrombospondin-1 and integrin associated protein (CD47).
12351399 2002 Mechanisms of CD47-induced caspase-independent cell death in normal and leukemic cells: link between phosphatidylserine exposure and cytoskeleton organization.
12218055 2002 Regulation of integrin function by CD47 ligands. Differential effects on alpha vbeta 3 and alpha 4beta1 integrin-mediated adhesion.
12176912 2002 Absence of CD47 in protein 4.2-deficient hereditary spherocytosis in man: an interaction between the Rh complex and the band 3 complex.
11980922 2002 Interactions of thrombospondins with alpha4beta1 integrin and CD47 differentially modulate T cell behavior.
11907074 2002 Interaction between Src homology 2 domain bearing protein tyrosine phosphatase substrate-1 and CD47 mediates the adhesion of human B lymphocytes to nonactivated endothelial cells.
11509594 2001 Bidirectional negative regulation of human T and dendritic cells by CD47 and its cognate receptor signal-regulator protein-alpha: down-regulation of IL-12 responsiveness and inhibition of dendritic cell activation.
11454874 2001 Normal ligand binding and signaling by CD47 (integrin-associated protein) requires a long range disulfide bond between the extracellular and membrane-spanning domains.
11331301 2001 An RGD sequence in the P2Y(2) receptor interacts with alpha(V)beta(3) integrins and is required for G(o)-mediated signal transduction.
11306274 2001 Integrin-associated protein (CD47) and its ligands.
10549293 1999 Ubiquitin-related proteins regulate interaction of vimentin intermediate filaments with the plasma membrane.
10545994 1999 CD47 ligation induces caspase-independent cell death in chronic lymphocytic leukemia.
10469599 1999 SHPS-1 is a scaffold for assembling distinct adhesion-regulated multi-protein complexes in macrophages.
10429193 1999 A CD9, alphaIIbbeta3, integrin-associated protein, and GPIb/V/IX complex on the surface of human platelets is influenced by alphaIIbbeta3 conformational states.
10397731 1999 Thrombospondin-1 acts via IAP/CD47 to synergize with collagen in alpha2beta1-mediated platelet activation.
10037797 1999 The vitronectin receptor and its associated CD47 molecule mediates proinflammatory cytokine synthesis in human monocytes by interaction with soluble CD23.
9872987 1999 Integrin-associated protein is a ligand for the P84 neural adhesion molecule.
9169439 1997 Thrombspondin acts via integrin-associated protein to activate the platelet integrin alphaIIbbeta3.
8563755 1996 Candidate gene acting as a suppressor of the RH locus in most cases of Rh-deficiency.
8550562 1996 Integrin-associated protein is a receptor for the C-terminal domain of thrombospondin.
8294396 1994 Rh-related antigen CD47 is the signal-transducer integrin-associated protein.
7998989 1994 Isolation and characterization of CD47 glycoprotein: a multispanning membrane protein which is the same as integrin-associated protein (IAP) and the ovarian tumour marker OA3.
7691831 1993 Molecular cloning of integrin-associated protein: an immunoglobulin family member with multiple membrane-spanning domains implicated in alpha v beta 3-dependent ligand binding.
2277087 1990 Integrin-associated protein: a 50-kD plasma membrane antigen physically and functionally associated with integrins.
1394148 1992 An ovarian tumor marker with homology to vaccinia virus contains an IgV-like region and multiple transmembrane domains.