Property Summary

NCBI Gene PubMed Count 185
PubMed Score 849.01
PubTator Score 1364.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
hemolytic-uremic syndrome 28 0.0 4.0

Expression

  Differential Expression (26)

Disease log2 FC p
interstitial lung disease -1.200 3.1e-02
Multiple myeloma 1.697 7.6e-03
malignant mesothelioma -1.600 1.3e-05
astrocytic glioma 1.200 7.6e-03
ependymoma 1.600 5.3e-03
oligodendroglioma 1.400 6.4e-03
osteosarcoma 1.826 1.1e-04
atypical teratoid / rhabdoid tumor 2.200 1.7e-04
glioblastoma 1.400 3.4e-02
medulloblastoma 1.300 5.1e-03
medulloblastoma, large-cell 2.000 1.4e-04
primitive neuroectodermal tumor 1.200 3.5e-04
hereditary spastic paraplegia -1.162 1.2e-02
intraductal papillary-mucinous adenoma (... 1.100 3.9e-03
intraductal papillary-mucinous carcinoma... 1.500 1.4e-05
intraductal papillary-mucinous neoplasm ... 1.600 2.2e-02
colon cancer 1.300 2.1e-02
interstitial cystitis -1.300 5.5e-05
lung adenocarcinoma 1.861 3.0e-07
non-inflammatory breast cancer 1.200 2.3e-02
Pick disease -1.200 2.5e-04
progressive supranuclear palsy -1.200 1.6e-02
invasive ductal carcinoma 1.200 1.1e-02
ovarian cancer -1.800 2.0e-05
Gaucher disease type 1 -1.500 1.1e-03
dermatomyositis 1.100 2.5e-03

Protein-protein Interaction (2)

Gene RIF (136)

PMID Text
26746193 CD46 controls both Th1 activation and regulation via a miR-150-dependent mechanism.
26084023 gene deficiency results in defective Th1 cell induction due to failure in metabolic reprogramming
26054645 This review summarizes our current knowledge of disease-associated mutations in this complement inhibitor(CD46).
25879158 Each mutant C3b bound MCP at reduced affinity, providing a molecular basis for its reduced cofactor activity in atypical hemolytic uremic syndrome.
25787182 Data show that CD28 antigen costimulation modulates CD46 antigen surface expression on activated T cells.
25733390 Functional characterization of two novel non-synonymous alterations in CD46 and a Q950H change in factor H found in atypical hemolytic uremic syndrome patients.
25725314 Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy.
25710174 It was not discover any association between A304V or other CD46 SNPs and preeclampsia.
25320329 HIV-1 Gag associates with CD46 weakly in HeLa cells
25294155 Results suggest a possible role for multidrug resistance genes ABCA10 and ABCA6 in follicular lymphoma survival and add to the evidence that genetic variation in CD46 and IL8 may have prognostic implications follicular lymphoma.
25275127 HIV-1 Gag associates with CD46 weakly in HeLa cells
25188723 The mutations in the regulators CFH, CFI and MCP involve loss-of-function, whereas those for C3 involve gain-of-function.
24978917 The expression levels of CD46, CD55, and CD59 were significantly higher in colon cancer tissues compared with the normal adjacent colon tissues.
24664706 We found that CD46 and CD59 were decreased in retinal pigment epithelium cells in part, by their release in exosomes and apoptotic particles.
24635052 Transgenic hCD46/HLA-E expression reduced humoral xenoresponses since all were downregulated during ex vivo xenoperfusion of hCD46/HLA-E double transgenic pig forelimbs with human blood.
24321396 C3aR and CD46 activation via intrinsic generation of their respective ligands is an integral part of human Th1 (but not Th2) immunity.
24297460 The present study suggests that CD46 plays an important role in hepatocellular carcinoma carcinogenesis by regulating let-7b and miR-17.
24247905 patients with MCP mutations only have a good long-term prognosis with 15% to 20% disease recurrence after KTx
23760251 Thus, while nectin-4 and CD46 interact functionally with the measles virus H protein beta4-beta5 hydrophobic groove, SLAM merely covers it.
23731345 Mutations in membrane cofactor protein is associated with end-stage renal disease in a patient with hemolytic uremic syndrome caused by infections by Escherichia coli strains producing Shiga-like toxins.
23519521 Case Report: patient with atypical haemolytic uremic syndrome with combined membrane cofactor protein CD46 and complement factor I mutations undergoing successful kidney transplantation.
23391762 Hepatitis B virus X protein protects hepatoma and hepatic cells from complement-dependent cytotoxicity by up-regulation of CD46.
23376460 Data show that increased CD35, CD46, CD55 and CD59 on neutrophils and monocytes present potent markers of bacterial infection and viral infection.
23144765 Data show that calcitriol affects the CD46 pathway, and that it promotes anti-inflammatory responses mediated by CD46.
23086448 we found that CD46 regulated the expression of Notch receptors and ligands during T cell activation and that disturbance of the CD46-Notch crosstalk impeded induction of IFN-alpha and switching to IL-10.
23049856 HCV incorporates selectively CD59, but not CD46 or CD55, in its envelope to gain resistance to CML in serum of infected individuals
23042280 The aim of this study was to determine the transcript and protein levels of complement decay-accelerating factor (DAF) and membrane cofactor protein (MCP) in the placentas of women with acquired and inherited thrombophilia.
22761385 mumps virus (MuV) and vesicular stomatitis virus (VSV) assemble to include CD46 and CD55, two host cell regulators which inhibit propagation of complement pathways through distinct mechanisms.
22594569 The alternative pathway of complement may play a role in the pathogenesis of HELLP syndrome.
22544928 Prostaglandin (PG)E2 has a novel role in CD46 functions, which might at least partly explain the diverse roles of PGE2 in T cell functions.
22357652 Three CD46 variants (rs7144, rs11118580, and rs2724384) were significantly associated with measles virus-specific IgG levels (P = 0.008, P = 0.026, and P = 0.018, respectively).
22293503 Data suggest that HBXIP upregulates CD46, CD55 and CD59 through p-ERK1/2/NF-kappaB signaling to protect breast cancer from complement-dependent cytotoxicity.
22247341 in systemic lupus erythematosus, the expression of leukocyte MCP at the mRNA level is closely related to disease activity
22171659 Data show that mutations in CD46 and CFH did not predispose to systemic lupus erythematosus (SLE) or nephritis but was associated with earlier onset of nephritis.
22153652 The strongest associations replicated in both cohorts were found for four SNPs within CD46 (p-value<10(-3)) and five SNPs within CFH (p-value<5x10(-3)).
22086389 Subjects previously immunized with measles-mumps-rubella vaccine were genotyped for 66 candidate single nucleotide polymorphisms in the CD46, SLAM and CD209 genes.
21934552 Data indicate that integrin beta6, CD46, tissue factor, and chromosome 14 open reading frame 1 (C14ORF1), were identified as overexpressed on pancreatic cancer cell lines.
21858107 Data sshow that variants in SFTPD, CD46 and IL1R1 are associated with IPD in both EA and AA.
21840606 the A304V mutation in the MCP gene is not strongly associated with RM or FL.
21706448 Mutations in the MCP gene seems to be a common etiology of atypical hemolytic uremic syndrome in Czech patients
21617523 protein expression is an unfavorable prognostic factor in breast cancer cases
21545652 The lipopolysaccharide of Treponema denticola and Tannerella forsythia were the most potent for increasing the gene expression of CD55 and CD59, and to a lesser extent CD46, after a 48-h stimulation.
21450813 The simultaneous interaction of Measles virus glycoprotein-pseudotyped Lentivirus with both CD46 and SLAM is required to achieve efficient and stable transduction of B and T cells.
21283821 CD46 acts as a molecular rheostat to control human T cell activation through the regulation of processing of its cytoplasmic tails.
21177319 CD46 could be associated with the response to interferon-beta therapy in multiple sclerosis.
20925204 The absence of CD46H*1 homozygosity was more pronounced in women with recurrent spontaneous abortion in the Indian population.
20925204 Observational study of gene-disease association. (HuGE Navigator)
20865641 Studies indicate that discovery of genetic abnormalities in complement regulatory genes provide new insights into the influence of each abnormality on the disease outcome and opened new perspectives for disease management.
20843232 Fusobacterium nucleatum induced IL-6, IL-8, and MMP-9 gene expression and protein secretion by epithelial cells through interactions with cell surface CD46.
20800630 Adenovirus (Ad) 35 vectors are better than Ad5F35 vectors at inducing innate immune responses in murine dendritic cells expressing human CD46 and CD46 transgenic mice, even though both Ad vectors utilize the same receptor.
20638094 We show here that Adenovirus 11p virions downregulate CD46 on the surface of K562 cells as early as 5min p.i. Specific binding to CD46 by the Ad11p fiber knob was required to mediate downregulation.
20513133 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20106822 Observational study of gene-disease association. (HuGE Navigator)
20059470 Observational study of gene-disease association. (HuGE Navigator)
20057080 MV-H glycoprotein from an Edmonston MV variant & MV-binding fragment of CD46 receptor were overproduced in mammalian cells & used to crystallize MV-H-CD46 complex. Well diffracting crystals containing 2 complexes in the asymmetric unit were obtained
20018629 Neisseria gonorrhoeae and Neisseria meningitidis, stimulate presenilin/gammaS processing of CD46-cyt1 and CD46-cyt2, a mechanism by which signals are transduced via the cyt1 and cyt2 tails to regulate CD46-dependent cellular responses.
19957088 The induction of expression of CD46 by endothelial cells in dilated cardiomyopathy suggests that viruses targeting these receptors could more easily gain entry to heart cells after intravascular administration.
19878546 DAF and MCP regulate cell survival of human cervical cancer cells.
19861685 Association of factor H autoantibodies with deletions of CFHR1, CFHR3, CFHR4, and with mutations in CFH, CFI, CD46, and C3 in patients with atypical hemolytic uremic syndrome.
19845582 The transplantation of islets from hCD46 pigs resulted in graft survival and insulin-independent normoglycemia in four of five monkeys for the 3 months follow-up of the experiment
19837375 Thus, upon microorganism recognition, the cell surface pathogen receptor CD46 can directly trigger autophagy, a critical step to control infection.
19784949 the lack of cTreg function in optimizing B-cell responses could explain why some CD46-deficient patients develop common variable immunodeficiency
19737905 human CD46 enhanced the progression of necrotizing fasciitis
19662541 In non-Hodgkin lymphoma patients treated with rituximab plus chemotherapy, expression of CD46 was higher in patients with complete remission than in non-responders. CD59 expression may be related to resistance to rituximab.
19597833 Increased expression levels of these isoforms and special CD46 expression pattern of the human otic capsule might produce modified or pathological intracellular signalization that could create the possibility of persistent measles virus infection.
19457998 Paramyxoviruses simian virus 5 and mumps virus recruit host cell surface complement inhibitors, CD46, into progeny virions to limit C3-mediated neutralization.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19344414 Observational study of gene-disease association. (HuGE Navigator)
19198561 CD46 as a Measles virus cell entry receptor.
18842294 Observational study of gene-disease association. (HuGE Navigator)
18684945 CD46-induced Tregs play a role in intestinal immune homeostasis where they dampen unwanted effector T cell responses through local IL-10 and granzyme B production.
18677279 A special expression pattern and altered functions of CD46 could explain the organ-specific and virus-associated pathogenesis of otosclerosis.
18658028 An abnormal control of the complement alternative pathway is a risk factor for the occurrence of HELLP syndrome.
18598642 Observational study of gene-disease association. (HuGE Navigator)
18573902 these results argue that bacterial binding of human CD46 enhances bacterial survival and represents a novel pathogenic mechanism that contributes to the severity of group A streptococcal disease.
18524830 analysis of how species B adenovirus fiber structural variations impact CD46 association
18514989 Extensive analysis of other complement regulatory protein- and polymorphism-associated risk factors did not uncover a difference between the patient and his sister.
18287234 Measles virus can infect and produce syncytia in human polarized epithelial cell lines independently of SLAM and CD46 by using distinctive receptor-binding sites on its hemagglutinin.
17947513 It is concluded that the B1 and B2 species of Ad engage CD46 through similar binding surfaces.
17914026 Membrane cofactor protein mutations in atypical hemolytic uremic syndrome (aHUS), fatal Stx-HUS, C3 glomerulonephritis, and the HELLP syndrome.
17715217 SLAM and CD46 do not have a role in measles virus growth and syncytium formation in tumor cell lines
17617869 recurrence may be favored by vascular microchimerism, in which the mutated CD46 protein is produced in the in the kidney graft by endothelial cells originating from recipient.
17599974 posttransplantation outcome is poor in all complement mutation groups except for the MCP mutation group
17560639 SNPs present in both the SLAM and CD46 genes are associated with measurable and significant variations in antibody response after measles vaccination
17467801 Emm-dependent and -independent CD46 binding of clinical isolates of Streptococci confirms the importance of CD46 as a cell target that might confer pathogens some biological advantages over the host.
17412968 HHV-7 infection causes elevation of the CRPs CD46 and CD59, which may be a possible mechanism for HHV-7 to evade humoral immunity via complement.
17261436 MCP mutation and complete paternal uniparental disomy of chromosome 1 could have an additive effect in determining the severity of the hemolytic-uremic syndrome phenotype.
17116876 Ligation of CD46 on human T cells prevents recruitment of the microtubule organizing center, CD3, and perforin to the interface with the antigen-presenting cell and causes a reduction in IFN-gamma production.
17015676 CD3/CD46-induced T regulatory cell 1-like cells die through a process of abortive proliferation
16888016 Acts in cohort with fimbrial adhesion to promote the uptake of pathogenic Escherichia coli.
16735514 ADAM10-mediated release of CD46 from apoptotic vesicles may represent a form of strategy to allow restricted complement activation to deal with modified self
16690929 the N481Y substitution in the measles virus haemagglutinin allowed it to utilize CD46 as an alternative receptor, but its ability to use CD46 was rather low in CD46+ SLAM- cell lines
16621965 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16386793 Mutations in the complement regulators factor H, membrane cofactor protein (MCP), and factor I are associated with atypical hemolytic uremic syndrome.
16254377 CD46 is a major cellular receptor on A549 cells for all species B adenoviruses except types 3 and 7.
16253969 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16253969 The combination of homozygosity for both IL1B-511*1 and CD46H*2 alleles is a high risk factor for recurrent pregnancy loss.
16087667 CD46 has a role in tailoring innate immune recognition of apoptotic and necrotic cells
15919905 native conformation of the CCP2 domain is crucial for adenovirus serotype 35 binding and substitution of amino acids at positions 130 to 135 or 152 to 156 completely abolishes the receptor function of CD46
15845515 data support the notion that pilus-mediated gonococcal infection of epithelial cells can occur in a CD46-independent manner, thus questioning the function of CD46 as an essential pilus receptor for pathogenic neisseriae
15845255 co-purification of sCD46 and HHV-6 DNA from multiple sclerosis sera indicates that HHV-6 is tightly connected to its receptor, CD46, in the serum of multiple sclerosis patients
15808690 In transgenic pigs, has no effect on endogenous retrovirus.
15784724 there are naturally occurring susceptibility factors in CFH and MCP for the development of atypical haemolytic-uraemic syndrome
15385816 Does not provide additional bbenefit in preventing graft rejection in transgenic pig-baboon heart transplantation.
15378282 High levels of CD46 is associated with breast cancer
15336534 Expression of CD46 was not downregulated by the infection of measles virus strain S191 both on mRNA level and cellular surface protein level.
15308701 binding site with measles virus hemagglutinin: attachment sites for MV receptors SLAM and CD46 overlap on the globular head
15307194 functional activity of CD46 is not restricted to the tumor cell membranes but can be liberated in vesicles and by a metalloproteinase.
15307176 CD46 costimulation promotes a Th1-biased response in human CD4+ T lymphocytes. CD46 enhanced TCR/CD3-induced tyrosine phosphorylation of CD3zeta and ZAP-70.
15151618 Significant difference in intensity of the staining of CD55 and CD46 among cells in various layers of normal esophageal mucosa and esophageal carcinoma cells, but not in the staining of CD59.
15121049 Review discussing role of CD46 mutations in predisposition to hemolytic uremic syndrome.
15078926 all of the major splice forms of CD46 are predominant and functional binding sites of species B Adenovirus 3 on CD46-expressing rodent and human cells but may not be the sole receptor of species B Ads on human cells
15047806 serves as an attachment receptor for adenovirus-37
14962294 In pigs transgenic for human MCP, the transgene is expressed at similar levels to that in human embryonic neural tissue but at an insufficient level to prevent activation of the complement cascade.
14962279 Highly efficient CD46 function, controlling both classical and alternative pathway complement activation, which suggests it might be the complement regulator of choice to protect kidney xenografts from pig to papio.
14712499 CD46 is localized to the plasma membrane and may have a role in the development of breast cancer epithelial cells
14708531 Data show that CD46 affords protection from antibody-mediated rejection when mouse anti-pig serum was administered to scid mice bearing grafts from either CD46 transgenic or normal pigs.
14566051 Mutations predispose to development of familial hemolytic uremic syndrome.
12958316 elucidation of two pathways for CD46 internalization, which are regulated by the valence of cross-linking of CD46 and which utilize either clathrin-coated pits or pseudopodial extension
12915534 Adenovirus type 11 uses CD46 as a cellular receptor.
12869763 role in meningococcal disease; results suggest that CD46 facilitates pilus-dependent interactions at the epithelial mucosa
12724329 CD46 has a role as a receptor for fusion and entry of human herpesvirus 6 into target cells
12663806 Human herpesvirus 6 variant A glycoprotein H-glycoprotein L-glycoprotein Q complex is a viral ligand for human CD46
12540904 Co-engagement of CD3 and the complement regulator CD46 in the presence of IL-2 induces a Tr1-specific cytokine phenotype in human CD4+ T cells
12171934 CD46 isoforms function as receptors for human herpesvirus 6 and measles virus
12055630 CD46 plays a role in regulating T cell-induced inflammatory reaction and in fine-tuning the cellular immune response by bridging innate and acquired immunity.
12055245 For the classical pathway, MCP is the cofactor for C4b cleavage (and factor H for C3b cleavage); however, if the alternative pathway mediates C3b deposition, then MCP's cofactor activity is sufficient to restrict complement activation.
12050388 required for HHV-6A induced fusion from without
11983016 Production and characterization of a pig line transgenic for human membrane cofactor protein.
11901164 The findings reported here strongly suggest that pilus binding to CD46 is not a simple static process. Rather, they support a model in which pilus interaction with CD46 promotes signaling cascades important for Neisseria infectivity.
11858824 peripheral blood monocytes treated for 5--8 days with GM-CSF (i.e. mature Mphi) acquired the capacity to assemble CD9, alpha3-beta1 integrin and the tyrosine phosphatase SHP-1 with their CD46
11844145 Observational study of gene-disease association. (HuGE Navigator)
11739493 CD46 costimulation induces morphological changes in T cells and activates the MAP Kinase Signaling System

AA Sequence

MEPPGRRECPFPSWRFPGLLLAAMVLLLYSFSDACEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFY      1 - 70
IPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILY     71 - 140
CELKGSVAIWSGKPPICEKVLCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIYC    141 - 210
GDNSVWSRAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGFYLDGSDTIVCDSNSTWDPPV    211 - 280
PKCLKVLPPSSTKPPALSHSVSTSSTTKSPASSASGPRPTYKPPVSNYPGYPKPEEGILDSLDVWVIAVI    281 - 350
VIAIVVGVAVICVVPYRYLQRRKKKGTYLTDETHREVKFTSL                                351 - 392
//

Text Mined References (189)

PMID Year Title
26746193 2016 CD46 Activation Regulates miR-150-Mediated Control of GLUT1 Expression and Cytokine Secretion in Human CD4+ T Cells.
26084023 2015 Complement Regulates Nutrient Influx and Metabolic Reprogramming during Th1 Cell Responses.
26054645 2015 Complement regulator CD46: genetic variants and disease associations.
25879158 2015 The molecular and structural bases for the association of complement C3 mutations with atypical hemolytic uremic syndrome.
25787182 2015 Monocyte:T-cell interaction regulates human T-cell activation through a CD28/CD46 crosstalk.
25733390 2015 Functional characterization of two novel non-synonymous alterations in CD46 and a Q950H change in factor H found in atypical hemolytic uremic syndrome patients.
25725314 2015 Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy.
25710174 2015 Genetic analysis of membrane cofactor protein (CD46) of the complement system in women with and without preeclamptic pregnancies.
25344690 2014 Common variants associated with general and MMR vaccine-related febrile seizures.
25294155 2014 A comprehensive evaluation of the role of genetic variation in follicular lymphoma survival.
25188723 2014 New functional and structural insights from updated mutational databases for complement factor H, Factor I, membrane cofactor protein and C3.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24978917 2014 Systematic immunohistochemical analysis of the expression of CD46, CD55, and CD59 in colon cancer.
24664706 2014 Oxidized low-density-lipoprotein-induced injury in retinal pigment epithelium alters expression of the membrane complement regulatory factors CD46 and CD59 through exosomal and apoptotic bleb release.
24635052 Complement dependent early immunological responses during ex vivo xenoperfusion of hCD46/HLA-E double transgenic pig forelimbs with human blood.
24321396 2014 Human complement C3 deficiency: Th1 induction requires T cell-derived complement C3a and CD46 activation.
24297460 2014 Bioinformatic analysis of the membrane cofactor protein CD46 and microRNA expression in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247905 2013 Successful long-term treatment of TMA with eculizumab in a transplanted patient with atypical hemolytic uremic syndrome due to MCP mutation.
23760251 2013 The measles virus hemagglutinin ?-propeller head ?4-?5 hydrophobic groove governs functional interactions with nectin-4 and CD46 but not those with the signaling lymphocytic activation molecule.
23731345 2013 Two patients with history of STEC-HUS, posttransplant recurrence and complement gene mutations.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
23519521 2013 Successful long-term outcome after renal transplantation in a patient with atypical haemolytic uremic syndrome with combined membrane cofactor protein CD46 and complement factor I mutations.
23391762 2013 Hepatitis B virus X protein protects hepatoma and hepatic cells from complement-dependent cytotoxicity by up-regulation of CD46.
23376460 2013 Use of complement regulators, CD35, CD46, CD55, and CD59, on leukocytes as markers for diagnosis of viral and bacterial infections.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23235567 2013 Atypical postinfectious glomerulonephritis is associated with abnormalities in the alternative pathway of complement.
23144765 2012 Calcitriol modulates the CD46 pathway in T cells.
23086448 2012 The CD46-Jagged1 interaction is critical for human TH1 immunity.
23049856 2012 Specific acquisition of functional CD59 but not CD46 or CD55 by hepatitis C virus.
23042280 2012 Complement inhibitory proteins expression in placentas of thrombophilic women.
22761385 2012 Virion-associated complement regulator CD55 is more potent than CD46 in mediating resistance of mumps virus and vesicular stomatitis virus to neutralization.
22594569 2012 The genetics of the alternative pathway of complement in the pathogenesis of HELLP syndrome.
22544928 2012 Prostaglandin E2 affects T cell responses through modulation of CD46 expression.
22357652 2012 CD46 measles virus receptor polymorphisms influence receptor protein expression and primary measles vaccine responses in naive Australian children.
22293503 2012 HBXIP upregulates CD46, CD55 and CD59 through ERK1/2/NF-?B signaling to protect breast cancer cells from complement attack.
22247341 2012 Expression and significance of leukocyte membrane cofactor protein transcript in systemic lupus erythematosus.
22171659 2011 Mutations in genes encoding complement inhibitors CD46 and CFH affect the age at nephritis onset in patients with systemic lupus erythematosus.
22153652 2012 Common genetic variants in complement genes other than CFH, CD46 and the CFHRs are not associated with aHUS.
22086389 2011 The association of CD46, SLAM and CD209 cellular receptor gene SNPs with variations in measles vaccine-induced immune responses: a replication study and examination of novel polymorphisms.
21934552 2012 RNA interference characterization of proteins discovered by proteomic analysis of pancreatic cancer reveals function in cell growth and survival.
21858107 2011 Identifying host genetic risk factors in the context of public health surveillance for invasive pneumococcal disease.
21840606 2011 A case-control study of membrane cofactor protein mutations in two populations of patients with early pregnancy loss.
21706448 2012 Manifestation of atypical hemolytic uremic syndrome caused by novel mutations in MCP.
21617523 2011 CD46 Expression is an unfavorable prognostic factor in breast cancer cases.
21545652 2011 Effect of periodontopathogen lipopolysaccharides and proinflammatory cytokines on CD46, CD55, and CD59 gene/protein expression by oral epithelial cells.
21450813 2011 Measles virus glycoprotein-pseudotyped lentiviral vector-mediated gene transfer into quiescent lymphocytes requires binding to both SLAM and CD46 entry receptors.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21283821 2011 The dynamic processing of CD46 intracellular domains provides a molecular rheostat for T cell activation.
21177319 2011 CD46 in a Spanish cohort of multiple sclerosis patients: genetics, mRNA expression and response to interferon-beta treatment.
20925204 CD46 polymorphism: a probable risk factor for recurrent spontaneous abortion in a northern Indian population.
20865641 2010 Atypical hemolytic uremic syndrome associated with mutations in complement regulator genes.
20843232 2011 Fusobacterium nucleatum binding to complement regulatory protein CD46 modulates the expression and secretion of cytokines and matrix metalloproteinases by oral epithelial cells.
20800630 2010 Adenovirus serotype 35 vector-induced innate immune responses in dendritic cells derived from wild-type and human CD46-transgenic mice: Comparison with a fiber-substituted Ad vector containing fiber proteins of Ad serotype 35.
20638094 2010 Adenovirus 11p downregulates CD46 early in infection.
20534589 2010 Characterization of the membrane-targeting C1 domain in Pasteurella multocida toxin.
20513133 2010 Mutations in alternative pathway complement proteins in American patients with atypical hemolytic uremic syndrome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20106822 2010 Genetic disorders in complement (regulating) genes in patients with atypical haemolytic uraemic syndrome (aHUS).
20059470 2010 Epidemiological approach to identifying genetic predispositions for atypical hemolytic uremic syndrome.
20057080 2010 Crystallization and preliminary crystallographic analysis of the measles virus hemagglutinin in complex with the CD46 receptor.
20018629 2010 Presenilin/gamma-secretase cleaves CD46 in response to Neisseria infection.
19957088 2010 Dilated cardiomyopathy alters the expression patterns of CAR and other adenoviral receptors in human heart.
19878546 2009 Cooperation of decay-accelerating factor and membrane cofactor protein in regulating survival of human cervical cancer cells.
19861685 2010 Association of factor H autoantibodies with deletions of CFHR1, CFHR3, CFHR4, and with mutations in CFH, CFI, CD46, and C3 in patients with atypical hemolytic uremic syndrome.
19845582 2009 Long-term controlled normoglycemia in diabetic non-human primates after transplantation with hCD46 transgenic porcine islets.
19837375 2009 Autophagy induction by the pathogen receptor CD46.
19784949 2009 CD46-induced human Treg enhance B-cell responses.
19737905 2009 CD46 transgenic mouse model of necrotizing fasciitis caused by Streptococcus pyogenes infection.
19662541 2010 Expression of complement regulatory proteins: CD46, CD55, and CD59 and response to rituximab in patients with CD20+ non-Hodgkin's lymphoma.
19597833 2010 Restriction analysis of otosclerosis-associated CD46 splicing variants.
19457998 2009 The paramyxoviruses simian virus 5 and mumps virus recruit host cell CD46 to evade complement-mediated neutralization.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19396169 2009 A large-scale genome-wide association study of Asian populations uncovers genetic factors influencing eight quantitative traits.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19198561 2009 Measles virus and CD46.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18684945 2008 CD46-induced immunomodulatory CD4+ T cells express the adhesion molecule and chemokine receptor pattern of intestinal T cells.
18677279 2008 Disease-associated novel CD46 splicing variants and pathologic bone remodeling in otosclerosis.
18658028 2008 Factor H, membrane cofactor protein, and factor I mutations in patients with hemolysis, elevated liver enzymes, and low platelet count syndrome.
18598642 2008 Integrating host genomics with surveillance for invasive bacterial diseases.
18573902 2008 CD46 Contributes to the severity of group A streptococcal infection.
18524830 2008 Structural variations in species B adenovirus fibers impact CD46 association.
18514989 2008 Inherited deficiency of membrane cofactor protein expression and varying manifestations of recurrent atypical hemolytic uremic syndrome in a sibling pair.
18287234 2008 Measles virus infects both polarized epithelial and immune cells by using distinctive receptor-binding sites on its hemagglutinin.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17947513 2007 Species B adenovirus serotypes 3, 7, 11 and 35 share similar binding sites on the membrane cofactor protein CD46 receptor.
17914026 2008 Membrane cofactor protein mutations in atypical hemolytic uremic syndrome (aHUS), fatal Stx-HUS, C3 glomerulonephritis, and the HELLP syndrome.
17715217 2007 A human lung carcinoma cell line supports efficient measles virus growth and syncytium formation via a SLAM- and CD46-independent mechanism.
17617869 2007 Recurrence of HUS due to CD46/MCP mutation after renal transplantation: a role for endothelial microchimerism.
17599974 2007 Differential impact of complement mutations on clinical characteristics in atypical hemolytic uremic syndrome.
17560639 2007 Variations in measles vaccine-specific humoral immunity by polymorphisms in SLAM and CD46 measles virus receptors.
17467801 2007 Membrane cofactor protein (MCP, CD46) binding to clinical isolates of Streptococcus pyogenes: binding to M type 18 strains is independent of Emm or Enn proteins.
17412968 2007 Human herpesvirus 7 infection increases the expression levels of CD46 and CD59 in target cells.
17261436 2007 Unusual clinical severity of complement membrane cofactor protein-associated hemolytic-uremic syndrome and uniparental isodisomy.
17116876 2006 Ligation of the cell surface receptor, CD46, alters T cell polarity and response to antigen presentation.
17015676 2006 Cutting edge: abortive proliferation of CD46-induced Tr1-like cells due to a defective Akt/Survivin signaling pathway.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16888016 2006 CD46 (membrane cofactor protein) acts as a human epithelial cell receptor for internalization of opsonized uropathogenic Escherichia coli.
16735514 2006 ADAM10-mediated release of complement membrane cofactor protein during apoptosis of epithelial cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16690929 2006 Recombinant wild-type measles virus containing a single N481Y substitution in its haemagglutinin cannot use receptor CD46 as efficiently as that having the haemagglutinin of the Edmonston laboratory strain.
16621965 2006 Genetics of HUS: the impact of MCP, CFH, and IF mutations on clinical presentation, response to treatment, and outcome.
16386793 2006 Insights into hemolytic uremic syndrome: segregation of three independent predisposition factors in a large, multiple affected pedigree.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16254377 2005 CD46 is a cellular receptor for all species B adenoviruses except types 3 and 7.
16253969 2006 Maternal CD46H*2 and IL1B-511*1 homozygosity in T helper 1-type immunity to trophoblast antigens in recurrent pregnancy loss.
16087667 2005 CD46 plays a key role in tailoring innate immune recognition of apoptotic and necrotic cells.
15919905 2005 Localization of regions in CD46 that interact with adenovirus.
15845515 2005 CD46-independent binding of neisserial type IV pili and the major pilus adhesin, PilC, to human epithelial cells.
15845255 2005 Co-purification of soluble membrane cofactor protein (CD46) and human herpesvirus 6 variant A genome in serum from multiple sclerosis patients.
15808690 The effect of complement regulatory protein expression on pig endothelial cells to porcine endogenous retrovirus lyses by human sera.
15784724 2005 The development of atypical haemolytic-uraemic syndrome is influenced by susceptibility factors in factor H and membrane cofactor protein: evidence from two independent cohorts.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385816 2004 Transgenic expression in pig hearts of both human decay-accelerating factor and human membrane cofactor protein does not provide an additional benefit to that of human decay-accelerating factor alone in pig-to-baboon xenotransplantation.
15378282 2005 Do poor-prognosis breast tumours express membrane cofactor proteins (CD46)?
15336534 2004 Is mRNA and protein level of CD46 altered in measles virus vaccine strain S191-infected cells?
15308701 2004 Measles virus (MV) hemagglutinin: evidence that attachment sites for MV receptors SLAM and CD46 overlap on the globular head.
15307194 2004 Complement inhibitor membrane cofactor protein (MCP; CD46) is constitutively shed from cancer cell membranes in vesicles and converted by a metalloproteinase to a functionally active soluble form.
15307176 2004 CD46-mediated costimulation induces a Th1-biased response and enhances early TCR/CD3 signaling in human CD4+ T lymphocytes.
15151618 2004 Complement regulatory proteins in normal human esophagus and esophageal squamous cell carcinoma.
15121049 2004 Mutations in CD46, a complement regulatory protein, predispose to atypical HUS.
15078926 2004 The human membrane cofactor CD46 is a receptor for species B adenovirus serotype 3.
15047806 2004 Membrane cofactor protein is a receptor for adenoviruses associated with epidemic keratoconjunctivitis.
14962294 2004 Complement regulatory proteins are expressed at low levels in embryonic human, wild type and transgenic porcine neural tissue.
14962279 2004 Characterization of a CD46 transgenic pig and protection of transgenic kidneys against hyperacute rejection in non-immunosuppressed baboons.
14712499 2004 Analysis of the level of mRNA expression of the membrane regulators of complement, CD59, CD55 and CD46, in breast cancer.
14708531 2003 CD46 protects pig islets from antibody but not cell-mediated destruction in the mouse.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14615110 2003 Familial haemolytic uraemic syndrome and an MCP mutation.
14597734 2003 Down-regulation of CD46 by piliated Neisseria gonorrhoeae.
14566335 2003 CD46 is a cellular receptor for group B adenoviruses.
14566051 2003 Mutations in human complement regulator, membrane cofactor protein (CD46), predispose to development of familial hemolytic uremic syndrome.
12958316 2003 Ligand binding determines whether CD46 is internalized by clathrin-coated pits or macropinocytosis.
12915534 2003 Adenovirus type 11 uses CD46 as a cellular receptor.
12869763 2003 CD46 in meningococcal disease.
12724329 2003 Interaction of glycoprotein H of human herpesvirus 6 with the cellular receptor CD46.
12663806 2003 Human herpesvirus 6 variant A glycoprotein H-glycoprotein L-glycoprotein Q complex associates with human CD46.
12540904 2003 Activation of human CD4+ cells with CD3 and CD46 induces a T-regulatory cell 1 phenotype.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12171934 2002 Human Herpesvirus 6 and Measles Virus Employ Distinct CD46 Domains for Receptor Function.
12112588 2002 Characterization of human membrane cofactor protein (MCP; CD46) on spermatozoa.
12082081 2002 Dynamic interaction of VCAM-1 and ICAM-1 with moesin and ezrin in a novel endothelial docking structure for adherent leukocytes.
12055630 2002 Linking innate and acquired immunity: divergent role of CD46 cytoplasmic domains in T cell induced inflammation.
11983016 2002 Production and characterization of a pig line transgenic for human membrane cofactor protein.
11971006 2002 Identification of the streptococcal M protein binding site on membrane cofactor protein (CD46).
11901164 2002 CD46 is phosphorylated at tyrosine 354 upon infection of epithelial cells by Neisseria gonorrhoeae.
11858824 2002 Molecular assembly of CD46 with CD9, alpha3-beta1 integrin and protein tyrosine phosphatase SHP-1 in human macrophages through differentiation by GM-CSF.
11844145 2001 MCP-1 promoter polymorphism in Spanish patients with systemic lupus erythematosus.
11714708 2002 A functional interaction between CD46 and DLG4: a role for DLG4 in epithelial polarization.
11260136 2001 Attachment of Neisseria gonorrhoeae to the cellular pilus receptor CD46: identification of domains important for bacterial adherence.
10972291 2000 SLAM (CDw150) is a cellular receptor for measles virus.
10843656 2000 Cutting edge: CD46, a new costimulatory molecule for T cells, that induces p120CBL and LAT phosphorylation.
10751138 2000 Analysis of measles virus binding sites of the CD46 gene in patients with subacute sclerosing panencephalitis.
10741407 2000 CD46 (membrane cofactor protein) associates with multiple beta1 integrins and tetraspans.
10657632 2000 Membrane cofactor protein (MCP; CD46): isoform-specific tyrosine phosphorylation.
10619434 1999 CD46 is a cellular receptor for human herpesvirus 6.
10357804 1999 Crystal structure of two CD46 domains reveals an extended measles virus-binding surface.
9759896 1998 Membrane cofactor protein: importance of N- and O-glycosylation for complement regulatory function.
9661662 1998 A novel isoform of human membrane cofactor protein (CD46) mRNA generated by intron retention.
9659228 1998 Post-translational modification and intracellular localization of a splice product of CD46 cloned from human testis: role of the intracellular domains in O-glycosylation.
9551389 1998 Genetic studies into inherited and sporadic hemolytic uremic syndrome.
9379894 1997 Membrane cofactor protein (MCP or CD46) is a cellular pilus receptor for pathogenic Neisseria.
9185079 1997 Possible association of infertility with sperm-specific abnormality of CD46.
8764003 1996 The N-glycan of the SCR 2 region is essential for membrane cofactor protein (CD46) to function as a measles virus receptor.
8418811 1993 Characterization of a cDNA clone coding for human testis membrane cofactor protein (MCP, CD46).
8402913 1993 The human CD46 molecule is a receptor for measles virus (Edmonston strain).
8371352 1993 Human membrane cofactor protein (CD46) acts as a cellular receptor for measles virus.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8026516 1994 Identification and characterization of membrane cofactor protein (CD46) in the human kidneys.
7929741 1994 Inhibition of human spermatozoon-oocyte interaction in vitro by monoclonal antibodies to CD46 (membrane cofactor protein).
7884872 1995 Physical association of moesin and CD46 as a receptor complex for measles virus.
7708671 1995 Membrane cofactor protein (CD46) is a keratinocyte receptor for the M protein of the group A streptococcus.
7691939 1993 Characterization of the promoter region of the membrane cofactor protein (CD46) gene of the human complement system and comparison to a membrane cofactor protein-like genetic element.
7534417 1995 Measles virus and C3 binding sites are distinct on membrane cofactor protein (CD46).
3260937 1988 Molecular cloning and chromosomal localization of human membrane cofactor protein (MCP). Evidence for inclusion in the multigene family of complement-regulatory proteins.
2521358 1989 Structural gene for human membrane cofactor protein (MCP) of complement maps to within 100 kb of the 3' end of the C3b/C4b receptor gene.
2298462 1990 Human non-lineage antigen, CD46 (HuLy-m5): purification and partial sequencing demonstrates structural homology with complement-regulating glycoproteins.
2050389 1991 Alternatively spliced RNAs encode several isoforms of CD46 (MCP), a regulator of complement activation.
1953714 1991 Identification of four different CD46 (MCP) molecules with anti-peptide antibodies.
1717583 1991 Contribution of the repeating domains of membrane cofactor protein (CD46) of the complement system to ligand binding and cofactor activity.
1711570 1991 Membrane cofactor protein of the complement system: alternative splicing of serine/threonine/proline-rich exons and cytoplasmic tails produces multiple isoforms that correlate with protein phenotype.
1601037 1992 Tissue-specific and allelic expression of the complement regulator CD46 is controlled by alternative splicing.
1479546 1992 Homology of an acrosome-reacted sperm-specific antigen to CD46.