Property Summary

NCBI Gene PubMed Count 431
PubMed Score 36580.49
PubTator Score 1380.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count Z-score Confidence
CD40 ligand deficiency 2 4.172 2.1
Disease Target Count Z-score Confidence
Toxoplasmosis 16 7.222 3.6
Hypersensitivity reaction type II disease 235 7.211 3.6
Rubella 14 7.207 3.6
Macroglobulinemia 17 6.947 3.5
Hepatitis A 10 6.907 3.5
Hepatitis 61 6.824 3.4
Rheumatoid Arthritis 1171 6.478 3.2
Measles 20 6.45 3.2
Syphilis 18 6.436 3.2
Lyme disease 23 6.409 3.2
Exanthem 39 6.354 3.2
Infectious mononucleosis 15 6.287 3.1
Agammaglobulinemia 24 6.237 3.1
Cryoglobulinemia 15 6.233 3.1
Dengue disease 19 6.105 3.1
Leptospirosis 17 6.092 3.0
Hepatitis E 11 6.064 3.0
Hepatitis B 103 6.036 3.0
Cancer 2346 6.017 3.0
Kidney disease 397 5.988 3.0
Neuropathy 210 5.986 3.0
Anemia 252 5.966 3.0
Mumps 10 5.848 2.9
Vasculitis 64 5.84 2.9
Encephalitis 54 5.821 2.9
Thrombocytopenia 105 5.796 2.9
Polyneuropathy 30 5.777 2.9
X-linked hyper IgM syndrome 5 5.677 2.8
Immunoglobulin alpha deficiency 10 5.631 2.8
Chickenpox 6 5.505 2.8
Chikungunya 12 5.495 2.7
Scrub typhus 7 5.452 2.7
Meningitis 46 5.432 2.7
Q fever 11 5.362 2.7
Leprosy 77 5.343 2.7
Liver Cirrhosis 101 5.295 2.6
Meningoencephalitis 13 5.294 2.6
Tetanus 66 5.221 2.6
Malaria 140 5.144 2.6
tick-borne encephalitis 14 5.131 2.6
Leukopenia 42 5.112 2.6
Purpura 17 5.082 2.5
Brucellosis 24 5.053 2.5
cat-scratch disease 9 5.04 2.5
Lymphatic system disease 14 5.005 2.5
Hemorrhagic fever with renal syndrome 7 4.989 2.5
Typhoid fever 22 4.945 2.5
Herpes simplex 19 4.925 2.5
Acquired immunodeficiency syndrome 164 4.909 2.5
Multiple Sclerosis 498 4.859 2.4
Rift Valley fever 13 4.848 2.4
Allergic hypersensitivity disease 123 4.818 2.4
Diarrhea 155 4.802 2.4
tuberculosis 1563 4.786 2.4
Dermatitis 141 4.761 2.4
Chorioretinitis 6 4.727 2.4
Influenza 142 4.676 2.3
Atherosclerosis 275 4.667 2.3
Crimean-Congo hemorrhagic fever 10 4.633 2.3
Hepatitis D 10 4.608 2.3
Japanese encephalitis 6 4.568 2.3
Urticaria 53 4.565 2.3
Herpes zoster 7 4.525 2.3
Heart disease 279 4.513 2.3
Schistosomiasis 38 4.497 2.2
Yellow fever 14 4.447 2.2
Chlamydia 18 4.439 2.2
Parotitis 6 4.429 2.2
Inflammatory bowel disease 142 4.357 2.2
Spotted fever 7 4.33 2.2
Otitis media 32 4.319 2.2
Schnitzler syndrome 3 4.297 2.1
Hepatitis C 90 4.271 2.1
Diphtheria 23 4.264 2.1
Phlebotomus fever 6 4.261 2.1
Myelitis 8 4.25 2.1
Uveitis 103 4.246 2.1
Myositis 24 4.231 2.1
Conjunctivitis 18 4.221 2.1
Legionellosis 4 4.218 2.1
Amyloidosis 68 4.185 2.1
diabetes mellitus 1663 4.148 2.1
Hypertension 293 4.126 2.1
Hantavirus pulmonary syndrome 7 4.095 2.0
Bronchitis 44 4.09 2.0
Asthma 349 4.076 2.0
Tonsillitis 18 4.056 2.0
Dysgammaglobulinemia 9 4.039 2.0
Mixed connective tissue disease 16 4.037 2.0
Toxocariasis 6 4.022 2.0
Pertussis 17 4.005 2.0
Henoch-Schoenlein purpura 13 3.974 2.0
Cholangitis 20 3.972 2.0
Pericarditis 14 3.969 2.0
West Nile fever 6 3.948 2.0
Reactive arthritis 7 3.924 2.0
Filariasis 21 3.87 1.9
Chagas disease 34 3.862 1.9
Acute disseminated encephalomyelitis 8 3.856 1.9
Ankylosing spondylitis 138 3.854 1.9
CD40 deficiency 3 3.846 1.9
Cerebrovascular disease 231 3.824 1.9
periodontitis 269 3.823 1.9
Leishmaniasis 49 3.815 1.9
Pneumocystosis 18 3.807 1.9
Cholestasis 93 3.803 1.9
Arthropathy 34 3.8 1.9
Retinitis 9 3.791 1.9
Synovitis 72 3.785 1.9
Coccidioidomycosis 7 3.784 1.9
interstitial lung disease 292 3.78 1.9
Pharyngitis 17 3.747 1.9
Subacute sclerosing panencephalitis 10 3.746 1.9
Eosinophilia 65 3.728 1.9
Giardiasis 10 3.719 1.9
Severe Combined Immunodeficiency 46 3.719 1.9
Sleeping sickness 37 3.71 1.9
Bronchiectasis 29 3.692 1.8
Polyclonal hypergammaglobulinemia 5 3.65 1.8
sarcoidosis 368 3.65 1.8
Gastroenteritis 46 3.638 1.8
Thrombophilia 37 3.593 1.8
Heavy chain disease 6 3.568 1.8
Exanthema subitum 3 3.535 1.8
Poliomyelitis 11 3.516 1.8
Chronic fatigue syndrome 29 3.513 1.8
Wiskott-Aldrich syndrome 27 3.497 1.7
Cryptosporidiosis 12 3.491 1.7
Echinococcosis 28 3.488 1.7
Ehrlichiosis 9 3.483 1.7
Rheumatic fever 16 3.476 1.7
Monoclonal paraproteinemia 2 3.453 1.7
Lichen planus 17 3.44 1.7
Dysentery 13 3.409 1.7
POEMS syndrome 6 3.4 1.7
Urethritis 10 3.399 1.7
Erythema multiforme 15 3.396 1.7
Motor neuron disease 39 3.379 1.7
La Crosse encephalitis 6 3.368 1.7
Sinusitis 30 3.332 1.7
Infertility 163 3.321 1.7
Cholera 33 3.307 1.7
Respiratory failure 30 3.3 1.6
Candidiasis 48 3.299 1.6
Dental caries 67 3.289 1.6
Salpingitis 6 3.268 1.6
Inclusion conjunctivitis 8 3.267 1.6
Ornithosis 9 3.254 1.6
Melioidosis 11 3.246 1.6
Cysticercosis 12 3.243 1.6
Pelvic inflammatory disease 21 3.236 1.6
psoriasis 6685 3.235 1.6
Lassa fever 10 3.215 1.6
Gastritis 44 3.206 1.6
Aspergillosis 23 3.194 1.6
Spinal cord disease 22 3.191 1.6
Fascioliasis 18 3.172 1.6
Ataxia telangiectasia 32 3.161 1.6
T cell deficiency 7 3.127 1.6
Severe acute respiratory syndrome 26 3.124 1.6
Rhinitis 46 3.122 1.6
Felty's syndrome 7 3.074 1.5
Psoriatic arthritis 85 3.074 1.5
Neuroretinitis 2 3.066 1.5
Sneddon syndrome 4 3.011 1.5

Expression

Synonym

Accession P29965 CD40-L
Symbols IGM
IMD3
TRAP
gp39
CD154
CD40L
HIGM1
T-BAM
TNFSF5
hCD40L

Gene

PDB

1ALY   1I9R   3LKJ   3QD6  

  Ortholog (12)

 GO Function (1)

 CSPA Cell Line (2)

Gene RIF (399)

PMID Text
26986513 mCD40L-induced cell death mediated by NORE1A expression appeared to be independent of mCD40L-induced cell death mediated by sustained JNK activation since NORE1A inhibition did not affect JNK phosphorylation and vice versa
26706786 diagnostic value of soluble CD40 ligand (sCD40L) and vascular endothelial growth factor (VEGF) for Alzheimer's disease
26577033 Study allows identify significant different genetic heterogeneity between two investigated populations (France and Tunisia) and revealed discrepancies in the prevalence of CD40LG polymorphisms that may be explained by ethnic and geographic differences.
26576922 concentrations of the C-reactive protein, myeloperoxidase and soluble CD40 ligand taken from peripheral vein were closely similar to the concentration found in coronary blood of ACS patients
26545336 CD40/CD40L system plays a role in regulating bone mineral density.
26313915 CD40 ligand induces RIP1-dependent, necroptosis-like cell death in low-grade serous but not serous borderline ovarian tumor cells.
26279254 time changes of sCD40L over 1 month after myocardial infarct onset were associated with G894T eNOS polymorphism and with the VEGF concentrations, but not to the platelet CD62P expression
26268734 Studies suggest that the CD40/CD154 pathway represents a promising potential therapeutic target for the prevention of transplantation rejection.
26237513 plasma soluble CD40L levels are reduced by antiplatelet therapy with clopidogrel, but not associated with long-term ischemic outcomes in unselected consecutive aspirin-treated patients undergoing cardiac catheterization.
26214492 The study findings showed that plasma sCD40L, fetuin-A, and PAPP-A levels are associated with carotid plaque formation and instability.
More...

AA Sequence

MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQ      1 - 70
RCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNPQIAAHVISEASSKTTSVLQW     71 - 140
AEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAAN    141 - 210
THSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL                       211 - 261
//

Text Mined References (431)

PMID Year Title
26986513 2016 NORE1A induction by membrane-bound CD40L (mCD40L) contributes to CD40L-induced cell death and G1 growth arrest in p21-mediated mechanism.
26706786 2016 Diagnostic utility of VEGF and soluble CD40L levels in serum of Alzheimer's patients.
26577033 2015 Development of a highly resolutive method, using a double quadruplex tetra-primer-ARMS-PCR coupled with capillary electrophoresis to study CD40LG polymorphisms.
26576922 2015 Systemic and coronary levels of CRP, MPO, sCD40L and PlGF in patients with coronary artery disease.
26545336 2016 The role of CD40 and CD40L in bone mineral density and in osteoporosis risk: A genetic and functional study.
26313915 2015 CD40 ligand induces RIP1-dependent, necroptosis-like cell death in low-grade serous but not serous borderline ovarian tumor cells.
26279254 2015 Changes of soluble CD40 ligand in the progression of acute myocardial infarction associate to endothelial nitric oxide synthase polymorphisms and vascular endothelial growth factor but not to platelet CD62P expression.
26268734 2015 Update on CD40 and CD154 blockade in transplant models.
26237513 2015 Soluble CD40 Ligand in Aspirin-Treated Patients Undergoing Cardiac Catheterization.
26214492 2015 Correlation of plasma soluble cluster of differentiation 40 ligand, alpha fetoprotein A, and pregnancy-associated plasma protein A with carotid plaque in patients with ischemic stroke.
More...