Property Summary

NCBI Gene PubMed Count 462
PubMed Score 37578.31
PubTator Score 1380.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
X-linked hyper IgM syndrome 4 5.733 2.9
Disease Target Count Z-score Confidence
Toxoplasmosis 17 7.27 3.6
Rubella 15 7.244 3.6
Hypersensitivity reaction type II disease 253 7.229 3.6
Macroglobulinemia 18 6.98 3.5
Hepatitis A 11 6.94 3.5
Measles 22 6.504 3.3
Rheumatoid arthritis 1191 6.498 3.2
Lyme disease 26 6.462 3.2
Exanthem 37 6.451 3.2
Syphilis 17 6.447 3.2
Infectious mononucleosis 14 6.326 3.2
Agammaglobulinemia 34 6.287 3.1
Cryoglobulinemia 18 6.272 3.1
Dengue disease 23 6.186 3.1
Leptospirosis 18 6.181 3.1
Hepatitis E 11 6.127 3.1
Hepatitis B 108 6.06 3.0
Neuropathy 261 6.047 3.0
Kidney disease 430 6.032 3.0
Cancer 2499 6.026 3.0
Anemia 365 5.999 3.0
Mumps 10 5.907 3.0
Encephalitis 64 5.894 2.9
Vasculitis 80 5.868 2.9
Polyneuropathy 64 5.837 2.9
Chikungunya 16 5.684 2.8
Immunoglobulin alpha deficiency 11 5.655 2.8
Scrub typhus 7 5.57 2.8
Chickenpox 8 5.566 2.8
Meningitis 67 5.473 2.7
Q fever 15 5.418 2.7
Leprosy 73 5.38 2.7
Meningoencephalitis 13 5.323 2.7
Liver Cirrhosis 181 5.297 2.6
Tetanus 68 5.272 2.6
Malaria 160 5.216 2.6
Leukopenia 72 5.203 2.6
tick-borne encephalitis 14 5.18 2.6
Brucellosis 24 5.141 2.6
Purpura 43 5.124 2.6
cat-scratch disease 9 5.104 2.6
Lymphatic system disease 15 5.034 2.5
Typhoid fever 22 5.023 2.5
Lymphoproliferative syndrome 58 4.995 2.5
Herpes simplex 18 4.994 2.5
Hemorrhagic fever with renal syndrome 7 4.987 2.5
Acquired immunodeficiency syndrome 197 4.947 2.5
Multiple Sclerosis 540 4.907 2.5
Japanese encephalitis 5 4.867 2.4
Allergic hypersensitivity disease 126 4.842 2.4
Rift Valley fever 14 4.838 2.4
tuberculosis 2010 4.827 2.4
Dermatitis 157 4.807 2.4
Chorioretinitis 6 4.781 2.4
Atherosclerosis 291 4.687 2.3
Influenza 142 4.672 2.3
Crimean-Congo hemorrhagic fever 9 4.641 2.3
Hepatitis D 10 4.632 2.3
Urticaria 67 4.568 2.3
Heart disease 306 4.53 2.3
Yellow fever 16 4.524 2.3
Schistosomiasis 35 4.52 2.3
Herpes zoster 68 4.506 2.3
Parotitis 6 4.46 2.2
Chlamydia 21 4.453 2.2
Inflammatory bowel disease 151 4.377 2.2
Schnitzler syndrome 4 4.369 2.2
Otitis Media 52 4.361 2.2
Spotted fever 8 4.353 2.2
Uveitis 103 4.318 2.2
Spinal cord disease 25 4.314 2.2
Hepatitis C 94 4.303 2.2
Phlebotomus fever 6 4.281 2.1
Myositis 30 4.269 2.1
Conjunctivitis 53 4.266 2.1
Legionellosis 4 4.244 2.1
CD40 ligand deficiency 2 4.205 2.1
Amyloidosis 67 4.203 2.1
Hypertension 396 4.189 2.1
diabetes mellitus 1728 4.179 2.1
Hantavirus pulmonary syndrome 6 4.12 2.1
Bronchitis 43 4.115 2.1
Asthma 385 4.097 2.0
Tonsillitis 16 4.097 2.0
Henoch-Schoenlein purpura 12 4.094 2.0
Mixed connective tissue disease 16 4.082 2.0
Pertussis 20 4.046 2.0
Toxocariasis 6 4.044 2.0
West Nile fever 7 4.02 2.0
Cholangitis 32 4.008 2.0
Pericarditis 13 3.974 2.0
Reactive arthritis 7 3.948 2.0
Chagas disease 39 3.914 2.0
Ankylosing spondylitis 140 3.894 1.9
Retinitis 7 3.879 1.9
Filariasis 21 3.871 1.9
Cerebrovascular disease 238 3.86 1.9
Leishmaniasis 47 3.853 1.9
CD40 deficiency 4 3.847 1.9
interstitial lung disease 298 3.847 1.9
Coccidioidomycosis 8 3.841 1.9
Pneumocystosis 17 3.84 1.9
Diphtheria 40 3.818 1.9
Arthropathy 43 3.813 1.9
Bronchiectasis 64 3.81 1.9
Cholestasis 155 3.809 1.9
periodontitis 293 3.809 1.9
Acute disseminated encephalomyelitis 7 3.8 1.9
Severe combined immunodeficiency 51 3.792 1.9
Synovitis 78 3.786 1.9
Hypereosinophilic syndrome 71 3.777 1.9
Subacute sclerosing panencephalitis 11 3.762 1.9
Giardiasis 9 3.744 1.9
Pharyngitis 17 3.74 1.9
sarcoidosis 370 3.716 1.9
Sleeping sickness 37 3.687 1.8
Thrombophilia 38 3.66 1.8
Polyclonal hypergammaglobulinemia 5 3.659 1.8
Gastroenteritis 41 3.637 1.8
Poliomyelitis 14 3.635 1.8
Chronic fatigue syndrome 25 3.63 1.8
Heavy chain disease 6 3.586 1.8
Monoclonal paraproteinemia 2 3.568 1.8
Wiskott-Aldrich syndrome 30 3.55 1.8
Exanthema subitum 3 3.531 1.8
Ehrlichiosis 9 3.524 1.8
POEMS syndrome 6 3.508 1.8
Cryptosporidiosis 13 3.485 1.7
Rheumatic fever 19 3.476 1.7
Echinococcosis 26 3.459 1.7
Lichen planus 16 3.443 1.7
Urethritis 10 3.401 1.7
Erythema multiforme 17 3.392 1.7
Dysentery 10 3.389 1.7
La Crosse encephalitis 5 3.389 1.7
Cholera 34 3.378 1.7
Motor neuron disease 49 3.354 1.7
Sinusitis 65 3.354 1.7
Infertility 188 3.343 1.7
Respiratory Failure 104 3.342 1.7
Candidiasis 55 3.301 1.7
Inclusion conjunctivitis 8 3.287 1.6
Ornithosis 9 3.283 1.6
Salpingitis 6 3.268 1.6
psoriasis 6694 3.249 1.6
Dental caries 164 3.24 1.6
Melioidosis 17 3.237 1.6
Gastritis 47 3.236 1.6
Immunodeficiency with hyper-IgM type 2 3 3.236 1.6
Salmonellosis 42 3.235 1.6
Cysticercosis 14 3.232 1.6
Aspergillosis 26 3.226 1.6
Neuroretinitis 2 3.219 1.6
Fascioliasis 17 3.217 1.6
Pelvic inflammatory disease 21 3.215 1.6
Ataxia telangiectasia 34 3.19 1.6
Lassa fever 9 3.182 1.6
Severe acute respiratory syndrome 27 3.145 1.6
Rhinitis 55 3.144 1.6
Microcephaly 166 3.132 1.6
Psoriatic arthritis 86 3.105 1.6
Felty's syndrome 7 3.086 1.5
Sneddon syndrome 4 3.048 1.5
Brachial plexus neuropathy 6 3.041 1.5
Bronchiolitis 18 3.027 1.5
Tularemia 23 3.017 1.5

Expression

 CSPA Cell Line (2)

Gene RIF (430)

AA Sequence

MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQ      1 - 70
RCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNPQIAAHVISEASSKTTSVLQW     71 - 140
AEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAAN    141 - 210
THSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL                       211 - 261
//

Text Mined References (463)

PMID Year Title