Property Summary

NCBI Gene PubMed Count 76
PubMed Score 223.52
PubTator Score 107.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 2.800 2.7e-04
interstitial cystitis 1.400 7.3e-03
lung cancer -1.700 9.5e-04
lung carcinoma -1.900 9.4e-13
osteosarcoma -1.616 4.6e-03
psoriasis 1.200 3.7e-38

 CSPA Cell Line (1)

Gene RIF (81)

AA Sequence

MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKK      1 - 70
KWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQD     71 - 140
GVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN                                141 - 182
//

Text Mined References (82)

PMID Year Title