Property Summary

NCBI Gene PubMed Count 26
PubMed Score 12.48
PubTator Score 17.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2714 5.3e-09
lung cancer 4473 3.1e-03
psoriasis 6685 9.7e-03

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.300 9.7e-03
lung cancer 1.200 3.1e-03
lung adenocarcinoma 1.400 5.3e-09

Protein-protein Interaction (9)

Gene RIF (19)

PMID Text
25917613 There was no interaction between NFKB1 polymorphisms and PPP1R13L and CD3EAP and smoking status in relation to lung cancer risk
23624123 In nonsmoking Chinese women CD3EAP rs967591 variant allele carriers are at increased risk of lung cancer.
22335888 variant alleles of PPP1R13L rs1970764 and CD3EAP rs967591 may contribute to risk factors of lung cancer.
21046104 Polymorphism in RAI and CD3EAP are associated with outcome of myeloma patients treated with high dose treatment.
21046104 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19734419 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19396015 A SNP in the 5' noncoding region of exon 1 at position -21 from the first codon, which does not affect the final AA sequence but may affect transcription/translation, was associated with drug sensitivity in the NC160 human cancer cell line panel.
19257887 Observational study of gene-disease association. (HuGE Navigator)
18289367 ASE-1 polymorphisms and the previously identified ASE-1 haplotype are not associated with risk of colorectal cancer.
18289367 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17131345 Observational study of gene-disease association. (HuGE Navigator)
16817948 Observational study of gene-disease association. (HuGE Navigator)
16817948 The ASE-1 polymorphism was associated with an increased risk of adenomas, OR of 1.39 (95% CI 1.06-1.81), which upon stratification was apparent among women only, OR of 1.66 (95% CI 1.15-2.39)
16809778 model for CAST/hPAF49 function in which the network of interactions of Pol I-specific subunits with UBF facilitates conformational changes of the polymerase, leading to stabilization of the Pol I-template complex and, thereby, activation of transcription
16690207 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15936590 Observational study of gene-disease association. (HuGE Navigator)
9426281 ASE-1 co-localises with the RNA polymerase I transcription initiation factor UBF/NOR-90 throughout all stages of the cell cycle and these two proteins associate with each other in vitro.

AA Sequence

MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVK      1 - 70
GKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPLQPIPASPPPQ     71 - 140
IPPGLRPRFCAFGGNPPVTGPRSALAPNLLTSGKKKKEMQVTEAPVTQEAVNGHGALEVDMALGSPEMDV    141 - 210
RKKKKKKNQQLKEPEAAGPVGTEPTVETLEPLGVLFPSTTKKRKKPKGKETFEPEDKTVKQEQINTEPLE    211 - 280
DTVLSPTKKRKRQKGTEGMEPEEGVTVESQPQVKVEPLEEAIPLPPTKKRKKEKGQMAMMEPGTEAMEPV    281 - 350
EPEMKPLESPGGTMAPQQPEGAKPQAQAALAAPKKKTKKEKQQDATVEPETEVVGPELPDDLEPQAAPTS    351 - 420
TKKKKKKKERGHTVTEPIQPLEPELPGEGQPEARATPGSTKKRKKQSQESRMPETVPQEEMPGPPLNSES    421 - 490
GEEAPTGRDKKRKQQQQQPV                                                      491 - 510
//

Text Mined References (40)

PMID Year Title
25917613 2015 NFKB1 common variants and PPP1R13L and CD3EAP in relation to lung cancer risk in a Chinese population.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23624123 2013 Effects of PPP1R13L and CD3EAP variants on lung cancer susceptibility among nonsmoking Chinese women.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22335888 2012 A specific diplotype defined by PPP1R13L rs1970764, CD3EAP rs967591 and ERCC1 rs11615 and lung cancer risk in a Chinese population.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21046104 2011 The importance of a sub-region on chromosome 19q13.3 for prognosis of multiple myeloma patients after high-dose treatment and stem cell support: a linkage disequilibrium mapping in RAI and CD3EAP.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19734419 2009 A polymorphism in NFKB1 is associated with improved effect of interferon-{alpha} maintenance treatment of patients with multiple myeloma after high-dose treatment with stem cell support.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19396015 2009 Association of a single nucleotide polymorphic variation in the human chromosome 19q13.3 with drug responses in the NCI60 cell lines.
19257887 2009 Haplotype frequencies in a sub-region of chromosome 19q13.3, related to risk and prognosis of cancer, differ dramatically between ethnic groups.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18289367 2008 A haplotype of polymorphisms in ASE-1, RAI and ERCC1 and the effects of tobacco smoking and alcohol consumption on risk of colorectal cancer: a Danish prospective case-cohort study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17131345 2007 Polymorphisms in the genes ERCC2, XRCC3 and CD3EAP influence treatment outcome in multiple myeloma patients undergoing autologous bone marrow transplantation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16817948 2006 Effects of polymorphisms in ERCC1, ASE-1 and RAI on the risk of colorectal carcinomas and adenomas: a case control study.
16809778 2006 RNA polymerase I-specific subunit CAST/hPAF49 has a role in the activation of transcription by upstream binding factor.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16690207 2007 Gene-environment interactions between smoking and a haplotype of RAI, ASE-1 and ERCC1 polymorphisms among women in relation to risk of lung cancer in a population-based study.
15936590 2005 Effect of polymorphisms in XPD, RAI, ASE-1 and ERCC1 on the risk of basal cell carcinoma among Caucasians after age 50.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15226435 2004 Multiple protein-protein interactions by RNA polymerase I-associated factor PAF49 and role of PAF49 in rRNA transcription.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10373416 1999 CAST, a novel CD3epsilon-binding protein transducing activation signal for interleukin-2 production in T cells.
9426281 1997 ASE-1: a novel protein of the fibrillar centres of the nucleolus and nucleolus organizer region of mitotic chromosomes.