Property Summary

NCBI Gene PubMed Count 70
PubMed Score 243.36
PubTator Score 98.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 2.400 1.6e-03
osteosarcoma -3.044 4.0e-05
intraductal papillary-mucinous neoplasm ... -1.100 2.2e-02
lung cancer -1.700 8.7e-04
interstitial cystitis 1.800 1.4e-03
primary Sjogren syndrome 2.300 1.0e-03
lung adenocarcinoma -1.215 1.8e-04
psoriasis 1.300 3.1e-09
lung carcinoma -1.600 1.5e-13
invasive ductal carcinoma 1.100 4.0e-02

 OMIM Phenotype (1)

 CSPA Cell Line (2)

Gene RIF (64)

PMID Text
26437631 A FOXP3(+)CD3(+)CD56(+)-expressed T-cell population with immunosuppressive function and reduced patient survival has been identified in cancer tissues of human hepatocellular carcinoma.
26109064 The docking site for CD3 subunits on the T Cell receptor beta chain has been identified by solution NMR.
25505066 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
25467409 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
25422432 analysis of the molecular organization of the TCR-CD3 complex
24495362 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
24288697 Two cases of SCID with CD3delta gene mutation in Mexican Mennonite infants are described.
24187576 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
23336327 The surface TCR expression of primary alphabeta and gammadelta T cells from healthy donors carrying a single null or leaky mutation in CD3G (gamma+/-) or CD3D (delta+/-, delta+/leaky) with that of normal controls, were compared.
22911005 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
22401598 Altered expression of the TCR signaling related genes CD3 and FcepsilonRIgamma in patients with aplastic anemia.
22103833 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
21984702 A transgenic T cell receptor gammadelta-low expressing subset of T cells accumulates in mouse ear keratinocytes after IL-23 injections.
21926461 report 2 unrelated cases of SCID with a selective block in alphabeta but not in gammadelta T cell development, associated with a new splicing mutation in the CD3D gene
21670311 A combination of trastuzumab antibody and phosphoantigen-stimulated gammadelta T-lymphocytes increases the efficacy of trastuzumab alone against HER-2-positive breast carcinoma cell lines in vivo and mammary carcinoma xenografts in mice.
21669059 Study characterized the expression pattern of CD3-gamma, -delta, -epsilon and -zeta chain genes from placenta, which contributes to further understanding of the features of T-cell immune status in placenta.
21669053 Data show that the expression pattern of the four CD3 chains was epsilon>zeta>delta>gamma in peripheral blood mononuclear cells from MM, while a gamma>epsilon>zeta>delta expression pattern was found in healthy controls.
20824090 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
20660709 Protein sequence comparison indicates that the CD3elta and CD3gamma subunits evolved with highly homologous heterodimeric interfaces and membrane proximal segments for efficient and specific signaling transfer when paired with CD3epsilon.
20594957 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
20511557 When compared with other human T cell subsets, T cell receptor/CD3-activated Vgamma9Vdelta2-expressing T cells display an unusually delayed and sustained intracellular calcium mobilization, dramatically quickened and shortened on costimulation by NKG2D.
20478055 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20179761 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
20012528 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
19759518 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
19726522 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
19724882 Data show CD3 epsilon pairs with CD3 gamma or with CD3 delta, forming CD3 epsilon gamma and CD3 epsilon delta heterodimers, which provide insight into our understanding of the molecular assembly of the CD3 molecular complex.
19222422 Observational study of gene-disease association. (HuGE Navigator)
19056690 Stage-dependent molecular changes in Notch signaling that are critical for normal human T-cell development.
18808677 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
18803280 Enumeration of NK cells and of T lymphocytes expressing TCR alpha/beta in human body effusions is not helpful in attempting to distinguish between benign and malignant effusions.
18541215 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
18473783 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
17928336 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
17923503 In CD3gamma-deficient patients there can be substitution of CD3gamma by the CD3delta chain and which can then support gammadelta T cell development.
17632570 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
17176095 The CD3 delta immune recognition receptor cytoplasmic domain binds to acidic and mixed phospholipid vesicles with a binding strength that correlates with the protein net charge and the presence of clustered basic amino acid residues.
17023417 analysis of TCRalpha-CD3deltaepsilon and TCRbeta-CD3gammaepsilon dimers and the role of the membrane-proximal tetracysteine motif
17001685 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
16888097 CD3delta and CD3gamma play a different role in humans and mice in pre-TCR and TCR function during alphabeta T-cell development
16777597 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
16412509 A human CD3 transgene that encodes full length CD3delta and a truncated but functional form of CD3epsilon restored the defective preTCR function in not only CD3epsilon- but CD3gamma- and CD3gammadelta-deficient mice as well.
15778375 a single, membrane-distal YxxO motif in CD3delta could mediate approximately 75% of receptor internalization, whereas its removal only reduced internalization by approximately 20%
15546002 SCID is caused by a CD3D deficiency.
15534202 crystal structure at 1.9-A resolution of a complex between a CD3-epsilon/delta ectodomain heterodimer and a single-chain fragment of the UCHT1 antibody
14602880 defect in CD3delta gene in severe combined immunodeficiency is characterized by the absence of T cells but normal B cells
12410792 CD3 epsilon undergoes a conformational change after dimerization with CD3 gamma or CD3 delta
10722370 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
9743208 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
9510190 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
9263011 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
9045614 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
8809126 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
8145026 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
8125527 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
7774645 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
7539755 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
7517794 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
7506554 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
2111780 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
1979339 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
1832084 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells
1385321 HIV-1 MA co-localizes with CD3 marker protein in monocyte-derived macrophages cocultured with HIV-1-infected primary CD4+ T-cells

AA Sequence

MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGI      1 - 70
YRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQ     71 - 140
ALLRNDQVYQPLRDRDDAQYSHLGGNWARNK                                           141 - 171
//

Text Mined References (73)

PMID Year Title
26437631 2015 Identification of a FOXP3(+)CD3(+)CD56(+) population with immunosuppressive function in cancer tissues of human hepatocellular carcinoma.
26109064 2015 Identification of the Docking Site for CD3 on the T Cell Receptor ? Chain by Solution NMR.
25422432 2014 Molecular architecture of the ?? T cell receptor-CD3 complex.
24288697 The respiratory presentation of severe combined immunodeficiency in two Mennonite children at a tertiary centre highlighting the importance of recognizing this pediatric emergency.
23336327 2013 Human CD3?, but not CD3?, haploinsufficiency differentially impairs ?? versus ?? surface TCR expression.
22401598 2012 Altered expression of the TCR signaling related genes CD3 and Fc?RI? in patients with aplastic anemia.
21984702 2011 Epidermal CCR6+ ?? T cells are major producers of IL-22 and IL-17 in a murine model of psoriasiform dermatitis.
21926461 2011 A leaky mutation in CD3D differentially affects ?? and ?? T cells and leads to a T??-T??+B+NK+ human SCID.
21883749 2011 Genotype, phenotype, and outcomes of nine patients with T-B+NK+ SCID.
21670311 2011 Stimulated ?? T cells increase the in vivo efficacy of trastuzumab in HER-2+ breast cancer.
21669059 2011 The expression pattern of CD3 chain genes in fetal/maternal interface.
21669053 2011 Change in expression pattern of TCR-CD3 complex in patients with multiple myeloma.
20660709 2010 Distinctive CD3 heterodimeric ectodomain topologies maximize antigen-triggered activation of alpha beta T cell receptors.
20511557 2010 NKG2D costimulates human V gamma 9V delta 2 T cell antitumor cytotoxicity through protein kinase C theta-dependent modulation of early TCR-induced calcium and transduction signals.
20478055 2010 Evaluation of 6 candidate genes on chromosome 11q23 for coeliac disease susceptibility: a case control study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19724882 2009 In vitro preparation and characterization of the human CD3 epsilon epsilon homodimer and CD3 epsilon gamma and CD3 epsilon delta heterodimers.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19222422 2009 A haplotype in the inducible T-cell tyrosine kinase is a risk factor for seasonal allergic rhinitis.
19056690 2009 An early decrease in Notch activation is required for human TCR-alphabeta lineage differentiation at the expense of TCR-gammadelta T cells.
18803280 2009 Flow cytometric quantitation of natural killer cells and T lymphocytes expressing T-cell receptors alpha/beta and gamma/delta is not helpful in distinguishing benign from malignant body cavity effusions.
17923503 2007 Different composition of the human and the mouse gammadelta T cell receptor explains different phenotypes of CD3gamma and CD3delta immunodeficiencies.
17652306 2007 Keeping the (kinase) party going: SLP-76 and ITK dance to the beat.
17176095 2006 Lipid-binding activity of intrinsically unstructured cytoplasmic domains of multichain immune recognition receptor signaling subunits.
17023417 2006 A membrane-proximal tetracysteine motif contributes to assembly of CD3deltaepsilon and CD3gammaepsilon dimers with the T cell receptor.
16888097 2006 Overlapping functions of human CD3delta and mouse CD3gamma in alphabeta T-cell development revealed in a humanized CD3gamma-mouse.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16412509 2006 Different role for mouse and human CD3delta/epsilon heterodimer in preT cell receptor (preTCR) function: human CD3delta/epsilon heterodimer restores the defective preTCR function in CD3gamma- and CD3gammadelta-deficient mice.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15778375 2005 Plasticity and rigidity in adaptor protein-2-mediated internalization of the TCR:CD3 complex.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15546002 2004 Severe combined immunodeficiency caused by deficiency in either the delta or the epsilon subunit of CD3.
15534202 2004 Crystal structure of a human CD3-epsilon/delta dimer in complex with a UCHT1 single-chain antibody fragment.
15489916 2004 Function of the Src-family kinases, Lck and Fyn, in T-cell development and activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14602880 2003 Effect of CD3delta deficiency on maturation of alpha/beta and gamma/delta T-cell lineages in severe combined immunodeficiency.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12410792 2002 In vitro production and characterization of partly assembled human CD3 complexes.
12215456 2003 CD3 delta establishes a functional link between the T cell receptor and CD8.
11827988 2002 Adapters in lymphocyte signaling.
11048639 2000 The mechanism of phospholipase C-gamma1 regulation.
10722370 2000 Possible role of the plasminogen receptor as a site of interaction of the human immunodeficiency virus p24 immunosuppressive heptapeptide Ch7 with the host immune system.
9743208 1998 Increased PGE2 production mediates the in vitro inhibitory effect of the human immunodeficiency virus P24 immunosuppressive heptapeptide Ch7.
9582308 1998 Characterization of the region involved in CD3 pairwise interactions within the T cell receptor complex.
9510190 1998 Superinduction of IL-8 in T cells by HIV-1 Tat protein is mediated through NF-kappaB factors.
9485181 1998 Assembly of the TCR/CD3 complex: CD3 epsilon/delta and CD3 epsilon/gamma dimers associate indistinctly with both TCR alpha and TCR beta chains. Evidence for a double TCR heterodimer model.
9045614 1997 Immune hyperactivation of HIV-1-infected T cells mediated by Tat and the CD28 pathway.
8809126 1996 Interferon-gamma (IFN-gamma) can counteract the in vitro inhibitory effect of an HIV p24 immunosuppressive heptapeptide.
8621641 1996 Calnexin associates exclusively with individual CD3 delta and T cell antigen receptor (TCR) alpha proteins containing incompletely trimmed glycans that are not assembled into multisubunit TCR complexes.
8278814 1994 Retention of unassembled components of integral membrane proteins by calnexin.
8176201 1994 Differential expression of ZAP-70 and Syk protein tyrosine kinases, and the role of this family of protein tyrosine kinases in TCR signaling.
8020575 1994 The T cell antigen receptor alpha and beta chains interact via distinct regions with CD3 chains.
7719941 1995 TCR alpha-CD3 delta epsilon association is the initial step in alpha beta dimer formation in murine T cells and is limiting in immature CD4+ CD8+ thymocytes.
7517794 1994 An HIV p24 heptapeptide down-regulates antigen-specific responses in vitro interfering at the level of the T3-Ti complex.
7495730 1995 Composition of TCR-CD3 complex in human intestinal intraepithelial lymphocytes: lack of Fc epsilon RI gamma chain.
6095101 1984 Isolation of cDNA clones encoding the 20K T3 glycoprotein of human T-cell receptor complex.
3488209 1986 T3 delta pre-mRNA is transcribed from a non-TATA promoter and is alternatively spliced in human T cells.
3478717 1987 Evolutionary relationship between the T3 chains of the T-cell receptor complex and the immunoglobulin supergene family.
2939461 1986 Exon/intron organization of the genes coding for the delta chains of the human and murine T-cell receptor/T3 complex.
2859526 1985 Isolation and characterization of a cDNA clone encoding the murine homologue of the human 20K T3/T-cell receptor glycoprotein.
2826124 1987 Physical linkage of three CD3 genes on human chromosome 11.
2540970 1989 Dephosphorylation of the human T lymphocyte CD3 antigen.
2138083 1990 The implications of subunit interactions for the structure of the T cell receptor-CD3 complex.
2111780 1990 Immunoregulatory effect of a synthetic peptide corresponding to a region of protein p24 of HIV.
2017177 1991 Murine and human T-lymphocyte GATA-3 factors mediate transcription through a cis-regulatory element within the human T-cell receptor delta gene enhancer.
1831653 1991 Cloning of a novel cell type from human fetal liver expressing cytoplasmic CD3 delta and epsilon but not membrane CD3.
1826255 1991 The CD3-gamma and CD3-delta subunits of the T cell antigen receptor can be expressed within distinct functional TCR/CD3 complexes.
1385321 1992 The antigen-specific induction of normal human lymphocytes in vitro is down-regulated by a conserved HIV p24 epitope.
1372642 1992 Ontogeny of human natural killer (NK) cells: fetal NK cells mediate cytolytic function and express cytoplasmic CD3 epsilon,delta proteins.