Property Summary

NCBI Gene PubMed Count 206
PubMed Score 2528.25
PubTator Score 1601.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
chronic lymphocytic leukemia -1.077 5.1e-03
astrocytic glioma 1.400 7.3e-03
cutaneous lupus erythematosus 2.700 1.2e-03
osteosarcoma -1.997 1.6e-07
periodontitis 1.600 1.4e-25
Duchenne muscular dystrophy -1.029 5.1e-07
lung cancer -2.800 6.8e-06
interstitial cystitis 3.500 5.2e-05
primary Sjogren syndrome 1.300 2.5e-04
lung carcinoma -3.500 1.1e-22
ulcerative colitis 2.300 6.8e-05
psoriasis 2.200 8.6e-93

Gene RIF (194)

PMID Text
27064238 Results may imply that CD38 expression either reflects or participates in pathogenic mechanisms of HIV disease independently of cell cycling.
26852663 The frequencies of CD19+CD24hiCD38hi B-regulatory lymphocyte were significantly increased in children with beta-thalassemia.
26470437 alterations in content of soluble molecules CD38 are associated with characteristics of tumor process that indicates at their monitoring significance under malignant neoplasms of uterus
26407101 soluble CD38 (sCD38) in seminal plasma increases the capacitation of sperm via specific interactions between sCD38 and the CD31 on the sperm.
26371313 Genetic variation in CD38 and breastfeeding experience interact to impact infants' attention to social eye cues.
26365593 the expression of CD38+ on both CD4+, CD8+T lymphocytes from peripheral blood and CSF discriminated between viremic and non-viremic patients
26329660 Primary human melanoma cell lines suppress in vitro T cell proliferation through an adenosinergic pathway in which CD38 and CD73 play a prominent role.
26306999 The data suggest that ZO-1, along with CD38 and Zap-70, plays a role in cell cycle regulation in chronic B cell leukemia, and may be used as a prognostic marker in the disease monitoring.
26294209 CD38 is expressed on human MDSC-like cell population that is expanded in the peripheral blood of advanced-stage cancer patients.
26170397 Hairy-cell leukemia patients that were CD38-positive had a shorter mean time to salvage therapy than CD38-negative ones. CD38 expression in HCL drives poor prognosis by promoting survival and heterotypic adhesion.
26025338 study points to an association between maternal SNPs in the CD38 in Japanese women and susceptibility to preterm birth.
25975191 Upregulation of CD38 expression on multiple myeloma cells by all-trans retinoic acid improves the efficacy of daratumumab.
25881755 Peripheral blood CD38 bright CD8+ effector memory T cells predict acute graft-versus-host disease.
25865943 The majority of extranodal NK/T cell lymphoma cases were CD38 positive, which significantly correlated with poor outcomes.
25630761 CD38 and its related genes are highly expressed in human nasopharyngeal carcinoma cell lines.
25564959 genetic polymorphism is associated with diffuse large B-cell lymphoma susceptibility in Egyptians
25505279 Chronic lymphocytic leukemia cells express CD38 in response to Th1 cell-derived IFN-gamma by a T-bet-dependent mechanism.
25447548 The results indicate that the net charge of the N-terminal segment is important in determining the membrane topology of CD38 and that the type III orientation can be a functional form of CD38 for Ca(2)-signaling.
25404409 Increased numbers of circulating ICOS(+) and IL-21(+) Tfh and CD38(+) plasma cells may be exhibited by patients with recent diagnoses of primary biliary cirrhosis.
25310288 At the same time, CD38 overexpression affected the expression of PI3K, Akt, MDM2 and p53 in vivo
25175907 CD38 expression is regulated by micro-RNA 708 in airway smooth muscle cells.
24990614 CD38 has a role in chronic lymphocytic leukemia growth and trafficking
24987056 These results validate CD38 as a therapeutic target and support the current evaluation of this unique CD38-targeting functional antibody in phase I clinical trials in patients with CD38+ B-cell malignancies.
24967705 High levels of CD38 reduced intracellular (NAD+) levels and blocked acquired resistance by inhibiting the activity of the NAD+-dependent SIRT1 deacetylase
24896331 Studies indicate that vertebrate ADP-ribosyl cyclases (ARCs) Bst1 and CD38 with common gene structure of invertebrate ARC, suggesting the origin to the ancestor of bilaterian animals.
24884314 Higher percentages of CD34 + CD38- cells in apheresis products reflect inadequate in vivo purging and reliably distinguish samples enriched in LSCs from those involving mainly normal cells.
24846193 Increases in CD34(+)CD38(-)CD123(+) cells may reflect malignant clonal cells with aberrant differentiation, overproliferation, and decreased apoptosis in myelodysplastic syndrome, which were similar to acute myeloid leukemia.
24667918 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells
24635660 nominal associations were found between autism spectrum disorder scores and single-nucleotide polymorphisms in OXT, ARNT2 and CD38
24634087 Autism and features of regression-previously acquired speech lost in the second year of life. The younger sister, who also had asthma, inherited a maternal deletion of 4p15.32 that results in a BST1-CD38 fusion transcript.
24489445 PBMC from MM patients display a deregulated response related to CD38 activation pathway defects; CD38 may be functionally involved in the progression of this pathology via the secretion of high levels of IL-6 that protects neoplastic cells from apoptosis
24458227 results do not contradict the hypothesis of associations between personality traits and oxytocin-related gene variants; however, there are no statistically significant associations after correcting for multiple testing.
24397353 Data suggest that the uniquely increased expression of CD38 and E2F2 in rheumatoid arthritis (RA) synovial tissues contribute to the immunoactivation of the disease.
24396004 CD38 status was associated with behavior and psychological reactions within live interactions, as well as global relationship quality
24295520 results demonstrate that CD38(+) cells are a useful model to study effects of the cellular NAD levels on cellular processes and establish a new linker between cellular NAD levels and oxidative stress
24288111 Data suggest CD38 (CD38 antigen (p45) protein) and CD49d (alpha4 Integrin; very late antigen-4 alpha) are more than just markers of an aggressive chronic lymphocytic leukemia (CLL) cell type and play functional roles in pathobiology of CLL. [REVIEW]
24275509 CD38 is expressed within caveolae and its function is linked to the caveolar regulatory proteins.
24216102 These data suggest that both functional roles of CD38 might be important in the pathogenesis of B-CLL.
24209975 only one SNP in CD38 was significantly associated with social integration and that SNP predicted when using a dichotomized indicator of social connectedness, but not a continuous measure of social connectedness or the continuously married outcome.
24162774 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells
23940051 CD38-cADPR mediates bile acid-induced pancreatitis and acinar cell injury through aberrant intracellular Ca(2+) signaling.
23897063 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells
23826263 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells
23755763 Report diagnosis of multiple myeloma using two-color flow cytometry based on kappa/lambda ratios of CD38-gated plasma cells.
23729443 The frequency of CD38high antibody-secreting cells (ASCs) is increased during the acute phase of hepatitis A virus (HAV) infection. Substantial numbers of ASCs are non-HAV-specific and dominantly secrete IgM.
23718062 Increase in the level of serum PECAM-1/CD31, a CD38 non-substrate ligand, is associated with endothelial dysfunction and correlates with elevated PECAM-1/CD31 levels and the number of CD38-positive lymphocytes in bronchial asthma patients.
23716697 Data show that ADP-ribosylation of CtBP1-S/BARS by brefeldin A (BFA) occurs via synthesis of a BFA-ADP-ribose conjugate by the ADP-ribosyl cyclase CD38 and covalent binding of the BFA-ADP-ribose conjugate into the CtBP1-S/BARS NAD(+)-binding pocket.
23706103 Our data reveal that a high proportion of CD34+/CD38- cells is positively associated with a poor prognosis of childhood ALL, to further guide therapy of the disease.
23686733 Atorvastatin and rosiglitazone did not affect the expression of CD38.
23308177 PECAM1+/CD38+ Vascular Cells can be Identified in Human Foreskin and in Vascular Sprouts of Basal Cell Carcinomas.
23156678 in the tumor cells of patients with colorectal cancer the expression of the CD38 gene is heterogeneous.
23123429 Identification of ADP-ribosylation sites of CD38 mutants by precursor ion scanning mass spectrometry.
23100517 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells
23021410 The detection of the cytoplasmic kappa/lambda ratio of CD38-gated CD138(+) plasma cells may be a useful tool in the diagnosis of plasma cell myeloma.
22969159 The identification of these two forms of CD38 suggests that flipping the catalytic domain from the outside to the inside of the cell may be a mechanism regulating its signaling activity.
22955446 CD38 signals upregulate expression and functions of matrix metalloproteinase-9 in chronic lymphocytic leukemia cells.
22909798 Interleukin 22 is increased and correlated with CD38 expression in patients with B-chronic lymphocytic leukemia.
22807456 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells
22773691 miR-140-3p modulates CD38 expression in human airway smooth muscle cells through direct binding to the CD38 untranslated region and indirect mechanisms involving activation of p38 MAPK and NF-kappaB.
22721814 CD38 gene polymorphism is associated with chronic lymphocytic leukemia.
22677461 Studies indicate that both cyclic ADP-ribose (cADPR) and nicotinic acid adenine dinucleotide phosphate (NAADP) are generated by CD38/ADP-ribosyl cyclases.
22556157 In human airway smooth muscle cells, regulation of CD38 expression occurs by specific class I PI3K isoforms.
22338471 expression of CD38 antigen and ZAP-70 have an exceptional significance in the prediction of prognosis in CLL patients.
22336563 Reduced plasma oxytocin and both oxytocin receptor and CD38 risk alleles were related to less parental touch
22278094 This study provided evidence that rs3796863 of CD31 antigen impacts social processing on a very basic level.
22251373 Data indicate the simultaneous analysis of CD64 together with CD304 (Neuropilin-1) or the combination of CD11b and CD38 was suitable for the identification of rheumatoid arthritis (RA)patients with high current activity in synovitis.
22236458 study contributes to understanding of the physiological functions of CD38 enzyme, by reporting its enzyme activity distribution in healthy individuals and demonstrating a significant positive correlation with age
22171799 CD38 expression have independent prognostic value in early stage chronic lymphocytic leukaemia (CLL).
22142305 Structure-function relationships have been analyzed to assess the structural determinants important for catalyis-based inhibitors of NAD glycohydrolase activity of CD38.
22027397 Data show that in HIV-1-infected astrocytes, IL-1beta-induced increases in CD38 levels were regulated through the MAPK signaling pathway and by the transcription factor NF-kappaB.
22020217 NAADP hydrolysis depends, at least in part, on CD38 expression. CD38 is not necessary for NAADP production, but rather catalyses degradation of NAADP.
22002134 Analysis of CD38 and ZAP70 mRNA expression among cytogenetic subgroups of Iranian chronic-lymphocytic-leukemia patients.
21945028 We found a positive correlation between blood protein carbonyl groups with CD38 expression and a negative correlation with ZAP 70 expression
21933861 High levels of CD34+CD38low/-CD123+ blasts are predictive of an adverse outcome in acute myeloid leukemia
21893160 These results suggest that CD38 plays a general role in oxytocin secretion
21876768 These data argue for a prominent role of VLA-4 but not CD38 expression in the homing of chronic lymphocytic leukemia cells to bone marrow (BM) niches and in human BM infiltration.
21765022 The second decade of studies on CD38 in chronic lymphocytic leukemia will tell if the molecule is an effective target for antibody-mediated therapy in this currently incurable leukemia.
21716207 The determination of TK, ZAP-70 and CD38 together allows patients susceptible to a possible stage of the disease, to be identified.
21692849 CD38 expression by chronic lymphocytic leukemic cells was regulated not only by elements of the murine microenvironment but also by co-engrafting non-malignant human T cells
21528155 Data show that the genotype of a SNP (rs6449182; C>G variation) in the CpG island of intron 1, harboring the retinoic-acid response element, exerts differential roles in CD38 expression in ASD and in parental LBC.
21518472 The 184 locus G allele of CD38 may be protective against CML, and reduce the risk of CML relapse.
21463115 Data show there was no correlation between the MDR1 genotypes and Binet stage, unmutated immunoglobulin heavy-chain variable region (IGHV) status, CD38 expression, ZAP-70 expression, and p53 deletion.
21423200 Synergistic TLR agonist stimulation in combination with IFN-alpha and IFN-gamma was the best method for regulating CD38 and CD74 expression
21387169 N-terminal of CD38 expressed on the cell surface functions as a receptor for an unknown ligand and triggers positive signals for insulin secretion
21330473 Whereas interleukin 3 receptor alpha expression is undetectable on normal CD34(+)CD38(-) stem cells, it is overexpressed on CD34(+)CD38(-) cells from Fanconi anemia patients with acute myeloid leukemia.
21330325 Data demonstrated that CD34(+)CD38(-/lo) hematopoietic stem cells from cord blood contained a two-fold higher T-lineage generation capacity than CD34(+)CD38(-/lo) bone marrow hematopoietic stem cells.
21237436 CD38(+) lymphocytes represent abnormal mononuclear cell populations in atrophic oral lichen planus (OLP) lesions indicating forms of OLP might exist with different pathogenesis, despite similar histology and clinical behavior.
21212793 CD38 upregulation was primarily conditioned by the presence of E2A and then by the G allele
21182206 A focal point for probing a possible relationship between CD38, an important immune cell marker, and ASD is the link between autism and autoimmune diseases
21156171 Data show that neither a specific CD38 ectoenzyme inhibitor nor a point mutation that cripples enzymatic activity (CD38 E226Q) diminishes ATRA-induced differentiation or G1/0 arrest.
21153349 TNF-alpha regulation of CD38 expression in human airway smooth muscle: role of MAP kinases and NF-kappaB.
21134381 mutation of a key residue at the active site, E146, inhibits the hydrolysis activity of CD38 but greatly increases its cyclization activity
21085635 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells
21055809 Data indicate that high iLR expression was strongly correlated with negativity for CD38 and ZAP-70 expression and mutated IGVH gene status.
21051931 gene mutational status and CD38 expression correlated with good Methylation
20842205 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells
20693316 Data suggest that the differential induction of CD38 by TNF-alpha in ASMA cells is due to increased transcriptional regulation involving ERK and p38 MAPK activation and is independent of changes in NF-kappaB or AP-1 activation.
20640790 analysis of human CD38's wild type, E226 and E146 mutants
20638362 these data should provide an insight for elucidating the roles of CD38 in oxidative stresses and a novel perspective of dealing with the ischemia/reperfusion-related diseases.
20435366 Our results call for functional and expression assay to assess the biological effects of the variant. Furthermore, the W140 allele could be a potential risk factor for a subset of Japanese autism spectrum disorder patients.
20435366 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20002855 When combined with clinical staging, the presence of a detectable CD38 antigen expression can be used to improve the identification of chronic lymphocytic leukemia patients with more aggressive disease.
19956559 Results suggests that the CD31/CD38 axis activates genetic programs relevant for proliferative responses. It also indicates a contribution of this pathway to the processes mediating migration and homing.
19866343 higher proportion of protein-expressing B-cells in the blood of patients with systemic lupus erythematosus
19817952 CD38(+)CD8(+) T cells can be an appropriate immunological marker for early detection and antiviral therapeutic monitoring of human cytomegalovirus infection after orthotopic liver transplantation.
19679010 Studies indicate that among the multitude of prognostic markers evaluated in CLL patients, IgVH mutational status, ZAP-70, and CD38 are some of the most frequently reported.
19644143 Data show that reduced relative mean fluorescence of CD38 below a threshold value on CD34(+) cells diagnosed low-grade myelodysplastic syndrome with 95% sensitivity and 92% specificity.
19635790 Without the G306E mutation the c-Cbl unites CD38 with the signaling complex and delivers a MAPK signal that drives RA-induced differentiation.
19561535 Data indicate that T cell with the anti-CD38-CAR showed powerful cytotoxicity against B-NHL cells in vitro and in vivo.
19240243 CD38 SNPs rs6449182 and rs1800561 may affect CD38 expression and contribute to risk of B-CLL carcinogenesis.
19240243 Observational study of gene-disease association. (HuGE Navigator)
19117080 that CD38 undergoes dramatic structural changes at the receptor region and at the enzymatic region in the presence of calcium.
19052657 Results show that CD38 and CD157 are expressed constitutively by corneal cells: CD38 appears as a 45-kDa monomer, while CD157 is a 42- to 45-kDa doublet.
19021053 Simultaneous analysis of ZAP-70, CD38 and IGHV mutations in CLL provides more discriminatory prediction of treatment-free interval than any factor alone
18940667 human CD38, an NAD-utilizing enzyme, is capable of catalyzing the cleavage reactions through both covalent and noncovalent intermediates, depending on the substrate used
18759251 the presence of nuclear CD38 by immunofluorescence and confocal microscopy using a panel of hematopoietic cell lines that exhibit different levels of CD38 plasma membrane expression.
18689273 positive ZAP-70 and CD38 status were associated with an unfavorable clinical course in chronic lymphocytic leukemia patients
18674817 CD38 was a good predictor of OS in Chinese patients with CLL.
18616755 The higher expression level of LPL was also associated with higher level of ZAP-70 and CD38, and more aggressive Binet stage in chronic lymphocytic leukema.
18581239 CD38-cyclic adenosine diphosphate-ribose (cADPR)-mediated increase in astrocyte intracellular divalent calcium ions plays an important role in potentiating neurotoxicity in HIV-1-associated neurocognitive disorder.
18534062 CD38(+) is a stable parameter for the identification of chronic lymphocytic leukemia patients with a more aggressive disease
18519815 data do not support an important contribution of CD38 triggering by CD31 to the proliferative and antiapoptotic state of the leukemic clone
18519230 There was a significant correlation between the percentage of leukemic cells positive for ZAP-70 and the percentage of CD38+CD19+ cells (R=0.629; p=0.000001).
18441094 Glucocorticoid regulation of CD38 expression in human airway smooth muscle cells: role of dual specificity phosphatase 1
18431797 Data suggest that detection of CD2 or CD13 expression in chronic lymphocytic leukemia (CLL) suggests familial CLL, and that CD38 expression does not carry the negative prognosis observed in sporadic CLL.
18424664 highest G allele frequency was observed in the 16 patients of the cohort that developed Richter syndrome
18424664 Observational study of gene-disease association. (HuGE Navigator)
18403265 CD38 is a dependable negative prognostic marker for chronic lymphocytic leukemia;In conjunction with chemokines and their receptors, CD38 influences cell migratory responses; (Review)
18341691 functional role of NF-kappaB, AP-1 and glucocorticoid response elements in the cd38 promoter in the transcriptional regulation of CD38
18326821 Proliferating tumor cells in lymph nodes express CD38, which is in turn associated with an increased number of CD31(+) vascular endothelial cells
18323656 CD38 expression was increased by isonicotinic acid and all-trans-retinoic acid
18322442 Regardless of CD38 expression level, CD38 and ZAP-70 expressions were significantly associated in B-CLL
18319522 association with B-cell chronic lymphocytic leukemia progression in western and asian enthnic populations
18212246 a new role for CD38 in modulating antigen-mediated T-cell responses during IS formation
18178673 These results indicate a critical role for CD38 in TNFalpha-induced enhancement of [Ca(2+)](i) in human airway smooth muscle cells.
18162778 staining for TCL1, CD38, and CD44 are useful ancillary tests to identify B-cell tumors
18024373 CD38 and ZAP-70 are expressed in lymph node leukemic cells in both good and poor prognosis patients
17931624 Results suggest that Zap-70 expression may be a better indicator of the mutational status of IgVH and prognosis of chronic lymphocytic leukemia than CD38 expression.
17852458 Erythrocyte NAD glycohydrolase and ADP-ribosyl cyclase activities were significantly increased in cancer, in parallel to enhancement of CD38 expression and in correlation with CEA values and anemia
17786980 CD38 at the interchromatin region whether linked to nuclear scaffold or stored in nuclear structures as micronuclei and Cajal bodies co-localizing with coilin, suggests its involvement in nuclear processes.
17684154 CD38 expression labels an activated subset within chronic lymphocytic leukemia clones enriched in proliferating B cells.
17591784 analysis of catalysis-associated conformational changes revealed by human CD38 complexed with a non-hydrolyzable substrate analog
17534928 Prognostic significance of combined analysis of ZAP-70 and CD38 in chronic lymphocytic leukemia was performed.
17440035 Borrelia garinii blocks the up-regulation of CCR7 and CD38, important molecules in DC migration to lymph nodes, thus affecting further immune responses in Lyme borreliosis infection.
17327405 lipid microdomain disruption and silencing of CD19 directly impacts on CD38's ability to mediate Ca(2+) fluxes, while leaving its surface expression unchanged
17322278 regulation of CD38 expression through p38 and JNK MAPKs involves NF-kappaB and AP-1 activation, and ERK and and p38 MAPKs also regulate expression posttranscriptionally through message stability
17287849 biological rationale for the poor prognosis of CD38(+) for chronic lymphocytic anemia patients.
17287729 results reveal that CD38 has a key role in neuropeptide release, thereby critically regulating maternal and social behaviours, and may be an element in neurodevelopmental disorders
17191385 Review. CD38 senses extracellular NAD release in infection/inflammation & produces cADPR. This regulates calcium signaling & chemotaxis in monocytes, neutrophils and dendritic cells.
17173996 These results indicate that cADPR is an intracellular messenger of Ca(2+) signalling, suggesting that CD38 can contribute to mAChR-cADPR signalling.
17107912 somatic mutation status and CD38 retained prognostic significance on multivariate analysis whereas ZAP-70 did not
17028452 We found a low incidence of CD38+ CLL patients, and CD38 expression predicted significantly a more advanced stage of the disease, shorter lymphocyte doubling time and shorter therapy- and progression-free time.
16932341 IRTA4/FcRH2 expression as detected by flow cytometry was significantly lower in the poor prognosis subgroup as compared to ZAP-70-CD38- B-chronic lymphocytic leukemia cells
16909600 Observational study of gene-disease association. (HuGE Navigator)
16861223 active sites of CD38 and ADP-ribosyl cyclase have roles in nicotinic acid adenine dinucleotide phosphate (NAADP) synthesis and hydrolysis activities
16841181 These results suggested that the N-linked glycosylation of CD38 plays a crucial role in the structure stability by preventing the formation inter-molecular cross-links.
16839787 results show that, in lymphoma cells, propensity to apoptosis was significantly linked to CD38 expression and that, remarkably, such response was independent of the nature of the trigger used
16825496 Combined analysis of CD38 in B-chronic lymphocytic leukemia and T cells is superior in predicting outcome of male B-CLL patients.
16642047 B-prolymphocytic leukemia appears biologically heterogeneous regarding IgVH mutations, ZAP-70 and CD38 expression, showing a pattern distinct from that of other lymphoproliferative disorders
16601673 TRPM2 is a potential molecular target for cADPR, which regulates Ca(2+) entry into pancreatic beta-cells at body temperature depending on the production of cADPR-related molecules, thereby regulating insulin secretion.
16571778 TNF-alpha-induced CD38 expression involves NF-kappaB expression and its activation and dexamethasone inhibits CD38 expression through NF-kappaB-dependent and -independent mechanisms.
16568475 Results showed a simple method of quantitation of CD38 expression to be sufficient to identify patients with an unfavourable prognosis in B cell chronic lymphocytic leukaemia.
16544364 anti-CD38 autoantibodies are more prevalent in long-standing than in new-onset type 1 diabetes, and more prevalent in type 2 than in type 1 diabetes. (review)
16369895 Observational study of gene-disease association. (HuGE Navigator)
16329108 Retinoic acid-induced CD38 expression in HL-60 myeloblastic leukemia cells regulates cell differentiation or viability depending on expression levels
16293598 localization of CD38 in lipid rafts and its multiple interactions with signaling receptors rule innate and adaptive immune responses by tuning DC migration, survival, and Th1-polarization ability
16154090 The crystal structure of the soluble extracellular domain of human CD38 to 1.9 A resolution was determined.
15964076 CD38 expression is augmented in ex vivo CD3+, CD4+, CD8+, and CD25+ systemic lupus erythematosus T cells, which correlates with its increased insolubility in Brij 98 detergent, and its translocation into lipid rafts.
15941914 leukocyte antigen-DR, CD38, and CD9 share a common pathway of tyrosine kinase activation in human monocytes
15764953 The level of CD38 expression on different T-cell subsets is differentially upregulated in drug-naive HIV-infected patients.
15759031 In the current study, ZAP-70 and CD38 expressions were examined in 252 patients with B-CLL. Surface CD38 expression on more than 30% (CD38(+)) of B-CLL cells were associated with an unfavorable clinical course.
15613544 CD38, a negative prognostic marker in B-cell chronic lymphocytic leukemia (B-CLL), plays a role in neoplastic B-cell growth and survival.
15556942 CD38 is stimulated by sequential activation of IL8 receptor, IP(3)-mediated Ca(2+) rise, and cGMP/protein kinase G and plays an essential role in IL8-induced migration of LAK cells
15219386 Observational study of gene-disease association. (HuGE Navigator)
15028729 concentrative influx of extracellular cADPR across CNT3 and cs-csg NT could substitute in the absence of CD38 in eliciting cADPR-dependent [Ca(2+)](i) increases in granulocyte-differentiated HL-60 cells, as well as in other CD38(-) cells
14990397 cADPR, in concert with IP(3), operates in airway gland acinar cells to mobilize Ca(2+), resulting in Cl(-) secretion.
14983032 Expression of CD38 on CD8+ T cells is associated with poor prognostic outcome in hiv infected individuals with detectable plasma viremia
14749705 CD38 overexpression is associated with B-cell chronic lymphocytic leukemia
14596927 findings indicate a novel negative feedback mechanism between RyR1 channel activity and CD38 abundance acts in cADPr signal transduction in lymphoma b-cells
14523017 CD38 operates in two functionally distinct microdomains of the plasma membrane
12917263 CD38 enhances thymocyte death by interacting with CD31 expressed by accessory cells and may play a role in passive immunity.
12854897 results suggest that CD38 is superior to myeloid-associated markers in predicting the prognosis of patients with B-CLL
12763926 CD38 is not merely a marker in B-CLL, but plays a receptor role with pathogenetic potential ruling the proliferation of the malignant clone.
12718937 CD38 receptor-mediated signals operate directly suggesting a Fcgamma receptorial surface molecule independent activation pathway. The key element for the receptor mediated signaling is represented by surface density of CD38 on resting monocytes.
12551845 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells
12386160 CD38 expression and the consequential accumulation of cADPR play a causal role in mediating cellular differentiation
12382646 expression level does not change in B-cell chronic lymphocytic leukemia
12368155 CD38 plays a role in the progression of B-chronic lymphocytic leukemia and can be used as a prognostic marker
12242463 Observational study of gene-disease association. (HuGE Navigator)
11836173 Low CD38 expression parallels a lower propensity to apoptosis. In vivo CD38 crosslinking by its ligand may play a pivotal role in B-CLL apoptosis, and chlorambucil affects CD38 levels.
10593874 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells
9263011 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells
7539755 HIV-1 gp120 upregulates the expression of CD38 (ADPRC1) in human B cells

AA Sequence

MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFPETVLARCVKY      1 - 70
TEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQR     71 - 140
DMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLNG    141 - 210
SRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR    211 - 280
PDKFLQCVKNPEDSSCTSEI                                                      281 - 300
//

Text Mined References (211)

PMID Year Title
27064238 2016 CD38 Expression in a Subset of Memory T Cells Is Independent of Cell Cycling as a Correlate of HIV Disease Progression.
26852663 2016 Regulatory B cells (CD19(+)CD38(hi)CD24(hi)) in alloimmunized and non-alloimmunized children with ?-thalassemia major.
26470437 2015 [THE SERUM LEVEL OF TOTAL AND OLIGOMERIC FRACTIONS OF SOLUBLE MOLECULES CD38 UNDER MALIGNANT TUMORS OF CERVIX AND UTERINE BODY].
26407101 2015 Seminal CD38 Enhances Human Sperm Capacitation through Its Interaction with CD31.
26371313 2015 Genetic variation in CD38 and breastfeeding experience interact to impact infants' attention to social eye cues.
26365593 2015 Increased CD38 expression on T lymphocytes as a marker of HIV dissemination into the central nervous system.
26329660 2015 A non-canonical adenosinergic pathway led by CD38 in human melanoma cells induces suppression of T cell proliferation.
26306999 2016 ZO-1 expression shows prognostic value in chronic B cell leukemia.
26294209 2015 CD38-Expressing Myeloid-Derived Suppressor Cells Promote Tumor Growth in a Murine Model of Esophageal Cancer.
26170397 2015 CD38 in Hairy Cell Leukemia Is a Marker of Poor Prognosis and a New Target for Therapy.
26025338 2015 The CD38 genotype (rs1800561 (4693C>T): R140W) is associated with an increased risk of admission to the neonatal intensive care unit.
25975191 2015 Upregulation of CD38 expression on multiple myeloma cells by all-trans retinoic acid improves the efficacy of daratumumab.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25881755 2015 Peripheral Blood CD38 Bright CD8+ Effector Memory T Cells Predict Acute Graft-versus-Host Disease.
25865943 2015 CD38 expression predicts poor prognosis and might be a potential therapy target in extranodal NK/T cell lymphoma, nasal type.
25630761 2016 CD38 is a putative functional marker for side population cells in human nasopharyngeal carcinoma cell lines.
25564959 2015 CD38 and interleukin 6 gene polymorphism in egyptians with diffuse large B-cell lymphoma (DLBCL).
25505279 2015 Chronic lymphocytic leukemia cells express CD38 in response to Th1 cell-derived IFN-? by a T-bet-dependent mechanism.
25447548 2015 Determinants of the membrane orientation of a calcium signaling enzyme CD38.
25404409 2015 Increased numbers of circulating ICOS? follicular helper T and CD38? plasma cells in patients with newly diagnosed primary biliary cirrhosis.
25310288 2014 CD38 is highly expressed and affects the PI3K/Akt signaling pathway in cervical cancer.
25175907 2014 MicroRNA-708 regulates CD38 expression through signaling pathways JNK MAP kinase and PTEN/AKT in human airway smooth muscle cells.
24990614 2015 The enzymatic activities of CD38 enhance CLL growth and trafficking: implications for therapeutic targeting.
24987056 2014 SAR650984, a novel humanized CD38-targeting antibody, demonstrates potent antitumor activity in models of multiple myeloma and other CD38+ hematologic malignancies.
24967705 2014 ATRA-induced cellular differentiation and CD38 expression inhibits acquisition of BCR-ABL mutations for CML acquired resistance.
24896331 2014 The ADP-ribosyl cyclases--the current evolutionary state of the ARCs.
24884314 2015 Higher percentage of CD34 + CD38- cells detected by multiparameter flow cytometry from leukapheresis products predicts unsustained complete remission in acute myeloid leukemia.
24846193 2014 Increased CD34+CD38 -CD123 + cells in myelodysplastic syndrome displaying malignant features similar to those in AML.
24635660 2014 Associations between oxytocin-related genes and autistic-like traits.
24634087 2014 A deletion involving CD38 and BST1 results in a fusion transcript in a patient with autism and asthma.
24489445 2013 CD38 ligation in peripheral blood mononuclear cells of myeloma patients induces release of protumorigenic IL-6 and impaired secretion of IFN? cytokines and proliferation.
24458227 2014 An attempt to identify single nucleotide polymorphisms contributing to possible relationships between personality traits and oxytocin-related genes.
24397353 2014 CD38 and E2F transcription factor 2 have uniquely increased expression in rheumatoid arthritis synovial tissues.
24396004 2014 Evidence for a role of the oxytocin system, indexed by genetic variation in CD38, in the social bonding effects of expressed gratitude.
24295520 2014 Overexpression of CD38 decreases cellular NAD levels and alters the expression of proteins involved in energy metabolism and antioxidant defense.
24288111 2014 The pathogenic relevance of the prognostic markers CD38 and CD49d in chronic lymphocytic leukemia.
24275509 2014 Inflammation, caveolae and CD38-mediated calcium regulation in human airway smooth muscle.
24216102 2013 Large changes in NAD levels associated with CD38 expression during HL-60 cell differentiation.
24209975 2014 Are genetic variations in OXTR, AVPR1A, and CD38 genes important to social integration? Results from two large U.S. cohorts.
23940051 2013 Cluster of differentiation 38 (CD38) mediates bile acid-induced acinar cell injury and pancreatitis through cyclic ADP-ribose and intracellular calcium release.
23755763 An approach for plasma cell myeloma diagnosis by two-color flow cytometry based on kappa/lambda ratios of CD38-gated plasma cells.
23729443 2013 Antibody-secreting cells with a phenotype of Ki-67low, CD138high, CD31high, and CD38high secrete nonspecific IgM during primary hepatitis A virus infection.
23718062 2013 [CD38/ADP-ribosyl cyclase, a marker of endothelial dysfunction in bronchial asthma].
23716697 2013 Molecular mechanism and functional role of brefeldin A-mediated ADP-ribosylation of CtBP1/BARS.
23706103 2014 High proportion of CD34+/CD38-cells is positively correlated with poor prognosis in newly diagnosed childhood acute lymphoblastic leukemia.
23686733 2013 The activity of atorvastatin and rosiglitazone on CD38, ZAP70 and apoptosis in lymphocytes of B-cell chronic lymphocytic leukemia in vitro.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23308177 2013 PECAM1(+)/Sca1(+)/CD38(+) vascular cells transform into myofibroblast-like cells in skin wound repair.
23156678 [Heterogeneous expression of CD38 gene in tumor tissue in patients with colorectal cancer].
23123429 2013 Identification of ADP-ribosylation sites of CD38 mutants by precursor ion scanning mass spectrometry.
23021410 2012 An approach for diagnosing plasma cell myeloma by three-color flow cytometry based on kappa/lambda ratios of CD38-gated CD138(+) cells.
22969159 2012 The membrane-bound enzyme CD38 exists in two opposing orientations.
22955446 2013 CD38 signals upregulate expression and functions of matrix metalloproteinase-9 in chronic lymphocytic leukemia cells.
22909798 2013 Interleukin 22 is increased and correlated with CD38 expression in patients with B-chronic lymphocytic leukemia.
22773691 2012 miR-140-3p regulation of TNF-?-induced CD38 expression in human airway smooth muscle cells.
22721814 2012 CD38 gene polymorphism and risk of chronic lymphocytic leukemia.
22677461 2012 Roles of cADPR and NAADP in pancreatic cells.
22556157 2012 Regulation of CD38 expression in human airway smooth muscle cells: role of class I phosphatidylinositol 3 kinases.
22338471 [Prognostic significance of new biological markers in chronic lymphocytic leukaemia].
22336563 2012 Sensitive parenting is associated with plasma oxytocin and polymorphisms in the OXTR and CD38 genes.
22278094 2012 Effects of a common variant in the CD38 gene on social processing in an oxytocin challenge study: possible links to autism.
22251373 2012 Identification and evaluation of novel synovial tissue biomarkers in rheumatoid arthritis by laser scanning cytometry.
22236458 2012 Population variability in CD38 activity: correlation with age and significant effect of TNF-? -308G>A and CD38 184C>G SNPs.
22171799 2012 Defining the prognosis of early stage chronic lymphocytic leukaemia patients.
22142305 2012 Catalysis-based inhibitors of the calcium signaling function of CD38.
22027397 2011 HIV-1 and IL-1? regulate astrocytic CD38 through mitogen-activated protein kinases and nuclear factor-?B signaling mechanisms.
22020217 2011 CD38: a NAADP degrading enzyme.
22002134 2011 Analysis of CD38 and ZAP70 mRNA expression among cytogenetic subgroups of Iranian chronic-lymphocytic-leukemia patients.
21945028 2011 Carbonyl group serum levels are associated with CD38 expression in patients with B chronic lymphocytic leukemia.
21933861 2011 High levels of CD34+CD38low/-CD123+ blasts are predictive of an adverse outcome in acute myeloid leukemia: a Groupe Ouest-Est des Leucemies Aigues et Maladies du Sang (GOELAMS) study.
21893160 2011 CD 38 expression, attachment style and habituation of arousal in relation to trust-related oxytocin release.
21876768 2011 Differential bone marrow homing capacity of VLA-4 and CD38 high expressing chronic lymphocytic leukemia cells.
21765022 2011 CD38 and chronic lymphocytic leukemia: a decade later.
21716207 2011 Identifying the stage of new CLL patients using TK, ZAP-70, CD38 levels.
21692849 2011 Investigating the role of CD38 and functionally related molecular risk factors in the CLL NOD/SCID xenograft model.
21528155 2011 All-trans retinoic acid upregulates reduced CD38 transcription in lymphoblastoid cell lines from Autism spectrum disorder.
21518472 2011 [Association of CD38 gene polymorphism with pathogenesis of chronic myeloid leukemia].
21463115 2011 Polymorphisms and haplotypes in multidrug resistance 1 gene are not associated with chronic lymphocytic leukemia susceptibility and prognostic parameters of chronic lymphocytic leukemia in Chinese population.
21423200 2011 Type I and II interferons enhance dendritic cell maturation and migration capacity by regulating CD38 and CD74 that have synergistic effects with TLR agonists.
21387169 2011 Expression of CD38 with intracellular enzymatic activity: a possible explanation for the insulin release induced by intracellular cADPR.
21330473 2011 Overexpression of IL-3R? on CD34+CD38- stem cells defines leukemia-initiating cells in Fanconi anemia AML.
21330325 2011 T-lymphoid differentiation potential measured in vitro is higher in CD34+CD38-/lo hematopoietic stem cells from umbilical cord blood than from bone marrow and is an intrinsic property of the cells.
21269460 2011 Initial characterization of the human central proteome.
21237436 2011 CD27 and CD38 lymphocytes are detected in oral lichen planus lesions.
21212793 2011 E2A is a transcriptional regulator of CD38 expression in chronic lymphocytic leukemia.
21182206 2010 Low CD38 expression in lymphoblastoid cells and haplotypes are both associated with autism in a family-based study.
21156171 2011 ATRA-induced HL-60 myeloid leukemia cell differentiation depends on the CD38 cytosolic tail needed for membrane localization, but CD38 enzymatic activity is unnecessary.
21153349 2011 TNF-? regulation of CD38 expression in human airway smooth muscle: role of MAP kinases and NF-?B.
21134381 2011 Dynamic conformations of the CD38-mediated NAD cyclization captured in a single crystal.
21055809 2011 High expression of the immature laminin receptor protein correlates with mutated IGVH status and predicts a favorable prognosis in chronic lymphocytic leukemia.
21051931 2011 Methylation markers identify high risk patients in IGHV mutated chronic lymphocytic leukemia.
20693316 2010 Differential induction of CD38 expression by TNF-{alpha} in asthmatic airway smooth muscle cells.
20640790 2010 Computational characterization for catalytic activities of human CD38's wild type, E226 and E146 mutants.
20638362 2010 Mouse embryonic fibroblasts from CD38 knockout mice are resistant to oxidative stresses through inhibition of reactive oxygen species production and Ca(2+) overload.
20435366 2010 Two genetic variants of CD38 in subjects with autism spectrum disorder and controls.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20002855 2010 CD38 as a prognostic marker in chronic lymphocytic leukaemia at a single New Zealand centre: patient survival in comparison to age- and sex-matched population data.
19956559 2010 CD38/CD31 interactions activate genetic pathways leading to proliferation and migration in chronic lymphocytic leukemia cells.
19866343 CD40-activated B cells from patients with systemic lupus erythematosus can be modulated by therapeutic immunoglobulins in vitro.
19817952 2010 Monitoring of CD95 and CD38 expression in peripheral blood T lymphocytes during active human cytomegalovirus infection after orthotopic liver transplantation.
19679010 2009 Incorporating prognostic information into treatment decisions in chronic lymphocytic leukemia.
19644143 2009 Reduced CD38 expression on CD34+ cells as a diagnostic test in myelodysplastic syndromes.
19635790 2009 c-Cbl tyrosine kinase-binding domain mutant G306E abolishes the interaction of c-Cbl with CD38 and fails to promote retinoic acid-induced cell differentiation and G0 arrest.
19561535 2009 Activated T-cell-mediated immunotherapy with a chimeric receptor against CD38 in B-cell non-Hodgkin lymphoma.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19240243 2009 CD38 gene polymorphisms contribute to genetic susceptibility to B-cell chronic lymphocytic leukemia: evidence from two case-control studies in Polish Caucasians.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19117080 2008 Conformational Closure of the Catalytic Site of Human CD38 Induced by Calcium.
19052657 CD38 and CD157 ectoenzymes mark cell subsets in the human corneal limbus.
19021053 2008 Combinations of ZAP-70, CD38 and IGHV mutational status as predictors of time to first treatment in CLL.
18940667 2008 Covalent and noncovalent intermediates of an NAD utilizing enzyme, human CD38.
18759251 2008 CD38 is constitutively expressed in the nucleus of human hematopoietic cells.
18689273 2006 Significance of zeta-associated protein (ZAP-70) and CD38 expression in chronic lymphocytic leukemia.
18674817 2009 CD38 as a prognostic factor in Chinese patients with chronic lymphocytic leukaemia.
18616755 2009 Expression level of lipoprotein lipase in Chinese patients with chronic lymphocytic leukemia and its correlation with other prognostic factors.
18581239 2008 CD38/cyclic ADP-ribose regulates astrocyte calcium signaling: implications for neuroinflammation and HIV-1-associated dementia.
18534062 2008 Is assessment of surface CD38 expression worthwhile as a prognostic factor in chronic lymphocytic leukemia patients?
18519815 2008 No convincing evidence for a role of CD31-CD38 interactions in the pathogenesis of chronic lymphocytic leukemia.
18519230 2008 ZAP-70 and CD38 expression are independent prognostic factors in patients with B-cell chronic lymphocytic leukaemia and combined analysis improves their predictive value.
18441094 2008 Glucocorticoid regulation of CD38 expression in human airway smooth muscle cells: role of dual specificity phosphatase 1.
18431797 2008 Immunophenotypic features distinguishing familial chronic lymphocytic leukemia from sporadic chronic lymphocytic leukemia.
18424664 2008 CD38 gene polymorphism and chronic lymphocytic leukemia: a role in transformation to Richter syndrome?
18403265 2008 CD38 at the junction between prognostic marker and therapeutic target.
18341691 2008 Regulation of the cd38 promoter in human airway smooth muscle cells by TNF-alpha and dexamethasone.
18326821 2008 CD38 expression in chronic lymphocytic leukemia is regulated by the tumor microenvironment.
18323656 2008 Changes in the gene expression of C-myc and CD38 in HL-60 cells during differentiation induced by nicotinic acid-related compounds.
18322442 2008 ZAP-70 protein expression and CD38 positivity in B-cell chronic lymphocytic leukemia.
18319522 2008 Immunophenotypic characterization of the leukemic B-cells from Iranian patients with chronic lymphocytic leukemia: association between CD38 expression and disease progression.
18212246 2008 Antigen-induced clustering of surface CD38 and recruitment of intracellular CD38 to the immunologic synapse.
18178673 2008 Regulation of store-operated Ca2+ entry by CD38 in human airway smooth muscle.
18162778 2008 Characteristic expression patterns of TCL1, CD38, and CD44 identify aggressive lymphomas harboring a MYC translocation.
18024373 2007 Regulation of CD38 in proliferating chronic lymphocytic leukemia cells stimulated with CD154 and interleukin-4.
17931624 2007 Zap-70 and CD38 as predictors of IgVH mutation in CLL.
17875758 2007 ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 expressing B-cell chronic lymphocytic leukemia.
17852458 2007 Erythrocyte CD38 as a prognostic marker in cancer.
17786980 2008 Insights into nuclear localization and dynamic association of CD38 in Raji and K562 cells.
17684154 2007 CD38 expression labels an activated subset within chronic lymphocytic leukemia clones enriched in proliferating B cells.
17591784 2007 Catalysis-associated conformational changes revealed by human CD38 complexed with a non-hydrolyzable substrate analog.
17534928 2007 Prognostic significance of combined analysis of ZAP-70 and CD38 in chronic lymphocytic leukemia.
17440035 2007 Transcriptional response of human dendritic cells to Borrelia garinii--defective CD38 and CCR7 expression detected.
17327405 2007 CD38/CD19: a lipid raft-dependent signaling complex in human B cells.
17322278 2007 TNF-alpha induced CD38 expression in human airway smooth muscle cells: role of MAP kinases and transcription factors NF-kappaB and AP-1.
17287849 2007 Highly purified CD38+ and CD38- sub-clones derived from the same chronic lymphocytic leukemia patient have distinct gene expression signatures despite their monoclonal origin.
17287729 2007 CD38 is critical for social behaviour by regulating oxytocin secretion.
17191385 2007 CD38: an ecto-enzyme at the crossroads of innate and adaptive immune responses.
17173996 2007 Overexpression of human CD38/ADP-ribosyl cyclase enhances acetylcholine-induced Ca2+ signalling in rodent NG108-15 neuroblastoma cells.
17107912 2006 CD38 expression level and pattern of expression remains a reliable and robust marker of progressive disease in chronic lymphocytic leukemia.
17028452 2006 Retrospective analysis of CD38 expression in 102 patients with B-CLL with a maximum follow-up of 18 years: incidence and prognostic significance.
16932341 2006 Gene expression signatures separate B-cell chronic lymphocytic leukaemia prognostic subgroups defined by ZAP-70 and CD38 expression status.
16909600 2006 [Clinical features and CD38 polymorphisms of latent autoimmune diabetes of adults (LADA) in Chengdu].
16861223 2006 Acidic residues at the active sites of CD38 and ADP-ribosyl cyclase determine nicotinic acid adenine dinucleotide phosphate (NAADP) synthesis and hydrolysis activities.
16841181 2007 N-linked glycosylation of CD38 is required for its structure stabilization but not for membrane localization.
16839787 2006 CD38 expression enhances sensitivity of lymphoma T and B cell lines to biochemical and receptor-mediated apoptosis.
16825496 2006 Expression levels of CD38 in T cells predict course of disease in male patients with B-chronic lymphocytic leukemia.
16690024 2006 NAADP+ synthesis from cADPRP and nicotinic acid by ADP-ribosyl cyclases.
16642047 2006 IgVH genes mutation and usage, ZAP-70 and CD38 expression provide new insights on B-cell prolymphocytic leukemia (B-PLL).
16601673 2006 TRPM2 activation by cyclic ADP-ribose at body temperature is involved in insulin secretion.
16571778 2006 Transcriptional regulation of CD38 expression by tumor necrosis factor-alpha in human airway smooth muscle cells: role of NF-kappaB and sensitivity to glucocorticoids.
16568475 2006 CD38 as a prognostic factor in B cell chronic lymphocytic leukaemia (B-CLL): comparison of three approaches to analyze its expression.
16544364 Anti-CD38 autoantibodies in type? diabetes.
16369895 2006 CD38 is associated with premenopausal and postmenopausal bone mineral density and postmenopausal bone loss.
16329108 2006 Retinoic acid-induced CD38 expression in HL-60 myeloblastic leukemia cells regulates cell differentiation or viability depending on expression levels.
16293598 2006 CD38 orchestrates migration, survival, and Th1 immune response of human mature dendritic cells.
16154090 2005 Crystal structure of human CD38 extracellular domain.
15964076 2006 Increased association of CD38 with lipid rafts in T cells from patients with systemic lupus erythematosus and in activated normal T cells.
15941914 2005 MHC class II/CD38/CD9: a lipid-raft-dependent signaling complex in human monocytes.
15764953 2005 Differential upregulation of CD38 on different T-cell subsets may influence the ability to reconstitute CD4+ T cells under successful highly active antiretroviral therapy.
15759031 2005 Combined analysis of ZAP-70 and CD38 expression as a predictor of disease progression in B-cell chronic lymphocytic leukemia.
15613544 2005 CD38 and CD100 lead a network of surface receptors relaying positive signals for B-CLL growth and survival.
15556942 2005 Activation of CD38 by interleukin-8 signaling regulates intracellular Ca2+ level and motility of lymphokine-activated killer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15219386 2004 CD38 polymorphisms in Spanish patients with systemic lupus erythematosus.
15028729 2004 Concentrative influx of functionally active cyclic ADP-ribose in dimethyl sulfoxide-differentiated HL-60 cells.
14990397 2004 Cyclic ADP-ribose, a putative Ca2+-mobilizing second messenger, operates in submucosal gland acinar cells.
14983032 2004 Relationship between the frequency of HIV-specific CD8+ T cells and the level of CD38+CD8+ T cells in untreated HIV-infected individuals.
14759258 2004 An unappreciated role for RNA surveillance.
14749705 2004 CD38 expression on B-cell chronic lymphocytic leukemic cells is strongly correlated with vascular endothelial growth factor expression.
14596927 2003 Activation of ryanodine receptor/Ca2+ release channels downregulates CD38 in the Namalwa B lymphoma.
14523017 2003 CD38 signaling in T cells is initiated within a subset of membrane rafts containing Lck and the CD3-zeta subunit of the T cell antigen receptor.
12917263 2003 Death of T cell precursors in the human thymus: a role for CD38.
12854897 2003 Relative importance of CD38 expression over myeloid-associated markers expression in predicting the clinical course of B-CLL patients.
12763926 2003 CD38 is a signaling molecule in B-cell chronic lymphocytic leukemia cells.
12718937 2002 CD38 ligation plays a direct role in the induction of IL-1beta, IL-6, and IL-10 secretion in resting human monocytes.
12529675 2003 CD38 expression by hematopoietic stem cells of newborn and juvenile mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461619 2002 CD38 is a marker of human lacteals.
12386160 2002 Evidence for a causal role of CD38 expression in granulocytic differentiation of human HL-60 cells.
12382646 2002 CD38 expression does not change in B-cell chronic lymphocytic leukemia.
12368155 2002 CD38 expression in B-chronic lymphocytic leukemia: association with clinical presentation and outcome in 155 patients.
12242463 2002 Autoimmunity to CD38 and GAD in Type I and Type II diabetes: CD38 and HLA genotypes and clinical phenotypes.
12063025 2002 Myeloid-lymphoid initiating cells (ML-IC) are highly enriched in the rhodamine-c-kit(+)CD33(-)CD38(-) fraction of umbilical cord CD34(+) cells.
11895784 2002 Human CD38 and CD16 are functionally dependent and physically associated in natural killer cells.
11683883 2001 NAD degradation and regulation of CD38 expression by human monocytes/macrophages.
10777496 2000 Interaction of two classes of ADP-ribose transfer reactions in immune signaling.
10636863 2000 Direct interaction of the CD38 cytoplasmic tail and the Lck SH2 domain. Cd38 transduces T cell activation signals through associated Lck.
10559984 1999 A new function for CD38/ADP-ribosyl cyclase in nuclear Ca2+ homeostasis.
10477767 1999 CD38/ADP-ribosyl cyclase: A new role in the regulation of osteoclastic bone resorption.
10432444 Human CD38, a surface receptor, an enzyme, an adhesion molecule and not a simple marker.
10376802 1999 Cyclic ADP-ribose: a novel Ca2+-mobilising second messenger.
9754820 1998 A missense mutation in the CD38 gene, a novel factor for insulin secretion: association with Type II diabetes mellitus in Japanese subjects and evidence of abnormal function when expressed in vitro.
9551996 1998 Human CD38 (ADP-ribosyl cyclase) is a counter-receptor of CD31, an Ig superfamily member.
9378973 1997 Human CD38, a leukocyte receptor and ectoenzyme, is a member of a novel eukaryotic gene family of nicotinamide adenine dinucleotide+-converting enzymes: extensive structural homology with the genes for murine bone marrow stromal cell antigen 1 and aplysian ADP-ribosyl cyclase.
9074508 1997 Human gene encoding CD38 (ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase): organization, nucleotide sequence and alternative splicing.
8420005 1993 Cyclic ADP-ribose in insulin secretion from pancreatic beta cells.
8253715 1993 Synthesis and hydrolysis of cyclic ADP-ribose by human leukocyte antigen CD38 and inhibition of the hydrolysis by ATP.
8172650 1994 Human CD38: a glycoprotein in search of a function.
7961800 1994 Essential cysteine residues for cyclic ADP-ribose synthesis and hydrolysis by CD38.
7835083 1995 Assignment of CD38, the gene encoding human leukocyte antigen CD38 (ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase), to chromosome 4p15.
7539755 1995 Modulation of CD4 lateral interaction with lymphocyte surface molecules induced by HIV-1 gp120.
2319135 1990 Isolation of a cDNA encoding the human CD38 (T10) molecule, a cell surface glycoprotein with an unusual discontinuous pattern of expression during lymphocyte differentiation.
1471258 1992 Similarities in amino acid sequences of Aplysia ADP-ribosyl cyclase and human lymphocyte antigen CD38.