Property Summary

NCBI Gene PubMed Count 27
PubMed Score 88.75
PubTator Score 63.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis -2.700 3.3e-03
cutaneous lupus erythematosus 2.400 1.7e-03
psoriasis -1.200 5.9e-03
osteosarcoma -3.510 1.8e-04
astrocytoma 1.800 1.1e-02
glioblastoma 1.900 3.7e-03
non-small cell lung cancer -1.847 3.7e-14
interstitial cystitis 2.700 3.9e-03
pediatric high grade glioma 1.500 2.5e-03
pilocytic astrocytoma 1.600 2.9e-05
subependymal giant cell astrocytoma 1.556 2.8e-02
invasive ductal carcinoma 1.500 2.5e-03
COPD -1.200 1.4e-03
lung carcinoma -2.400 1.6e-28
spina bifida 1.517 4.8e-02
ductal carcinoma in situ 1.500 2.3e-02
ulcerative colitis 2.500 8.9e-04

Gene RIF (11)

PMID Text
25934707 Data indicate that cell differentiation antigen 37 (CD37) is well expressed and a potential drug target in acute myeloid leukemia (AML).
25275127 Human CD37 is relocalized from plasma membrane to a perinuclear area in the presence of HIV-1 Vpu
24445867 The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model.
23883821 Data indicate that enhanced antibody-dependent cell cytotoxicity (ADCC) is observed against chronic lymphocytic leukemia cells and is sustained at concentrations of SMIP-016(GV) as low at 5E(-6) microg/mL on cells expressing minimal CD37 antigen.
22624718 Identify two tyrosine residues in tetraspanin CD37 directly mediating transduction of survival and apoptotic signals.
20709950 In the absence of both CD37 and Tssc6, immune function is further altered when compared with CD37- or Tssc6-deficient transgenic mice, demonstrating a complementary role for these two molecules in cellular immunity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17440052 provide strong justification for CD37 as a therapeutic target and introduce small modular immunopharmaceuticals as a novel class of targeted therapies for B-cell malignancies
17182550 CD37 is important for dectin-1 stabilization in APC membranes and controls dectin-1-mediated IL-6 production.
14978098 CD37 cross-linking on human T cells transduces signals that lead to complete inhibition of CD3-induced T cell proliferation.

AA Sequence

MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKVLAISGIFTMG      1 - 70
IALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAE     71 - 140
ESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARS    141 - 210
RHSADICAVPAESHIYREGCAQGLQKWLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARY    211 - 280
R//

Text Mined References (29)

PMID Year Title
25934707 2015 AGS67E, an Anti-CD37 Monomethyl Auristatin E Antibody-Drug Conjugate as a Potential Therapeutic for B/T-Cell Malignancies and AML: A New Role for CD37 in AML.
24445867 2014 The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model.
23883821 Glycovariant anti-CD37 monospecific protein therapeutic exhibits enhanced effector cell-mediated cytotoxicity against chronic and acute B cell malignancies.
22624718 2012 Tetraspanin CD37 directly mediates transduction of survival and apoptotic signals.
21930792 2011 SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling.
20709950 2010 A complementary role for the tetraspanins CD37 and Tssc6 in cellular immunity.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17440052 2007 Targeting CD37-positive lymphoid malignancies with a novel engineered small modular immunopharmaceutical.
17182550 2007 Dectin-1 interaction with tetraspanin CD37 inhibits IL-6 production.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14978098 2004 A regulatory role for CD37 in T cell proliferation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
10529602 1999 Functional expression of transmembrane 4 superfamily molecules on human eosinophils.
10405235 1999 Expression of tetraspans transmembrane family in the epithelium of the gastrointestinal tract.
10229664 1999 Selective tetraspan-integrin complexes (CD81/alpha4beta1, CD151/alpha3beta1, CD151/alpha6beta1) under conditions disrupting tetraspan interactions.
8452817 1993 Gene structure, chromosomal localization, and protein sequence of mouse CD53 (Cd53): evidence that the transmembrane 4 superfamily arose by gene duplication.
8436422 1993 The genes for CD37, CD53, and R2, all members of a novel gene family, are located on different chromosomes.
8119731 1994 Association of four antigens of the tetraspans family (CD37, CD53, TAPA-1, and R2/C33) with MHC class II glycoproteins.
3257508 1988 The B cell-associated CD37 antigen (gp40-52). Structure and subcellular expression of an extensively glycosylated glycoprotein.
2466944 1989 The primary structure of the human leukocyte antigen CD37, a species homologue of the rat MRC OX-44 antigen.
2388030 1990 The primary structure of the human leukocyte antigen CD37, a species homologue of the rat MRC OX-44 antigen.
1879540 1991 Novel structurally distinct family of leucocyte surface glycoproteins including CD9, CD37, CD53 and CD63.