Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.26
PubTator Score 5.02

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -5.110 1.2e-05
medulloblastoma, large-cell 1.300 1.9e-05
non-small cell lung cancer -2.042 1.5e-19
breast carcinoma -1.900 4.2e-05
fibroadenoma -2.000 1.2e-02
Breast cancer -6.800 2.2e-02
invasive ductal carcinoma -5.100 2.9e-05
psoriasis -1.400 4.7e-06
ductal carcinoma in situ -4.000 4.4e-05

Gene RIF (1)

PMID Text
25314291 Blood pressure, measured with a sensitive method, in a small sample of CD300LG rs72836561 CT-carriers was higher than in CC-carriers.

AA Sequence

MRLLVLLWGCLLLPGYEALEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEE      1 - 70
GQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQP     71 - 140
LATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPP    141 - 210
AGSSRPPMQLDSTSAEDTSPALSSGSSKPRVSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQ    211 - 280
ATETQRNEKFCLSRLTAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA                      281 - 332
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25314291 2014 Blood pressure levels in male carriers of Arg82Cys in CD300LG.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19592130 2009 The CD300 molecules regulate monocyte and dendritic cell functions.
19359216 2009 The CD300 family of molecules are evolutionarily significant regulators of leukocyte functions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16876123 2006 CD300 antigen like family member G: A novel Ig receptor like protein exclusively expressed on capillary endothelium.
16754720 2006 Nepmucin, a novel HEV sialomucin, mediates L-selectin-dependent lymphocyte rolling and promotes lymphocyte adhesion under flow.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.