Property Summary

NCBI Gene PubMed Count 25
PubMed Score 43.40
PubTator Score 19.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.500 4.0e-04
atypical teratoid / rhabdoid tumor 1.100 3.0e-04
ductal carcinoma in situ 1.200 4.4e-03
glioblastoma 1.200 4.6e-06
head and neck cancer and chronic obstruc... 1.200 4.2e-04
interstitial cystitis 1.700 2.8e-03
invasive ductal carcinoma 1.700 1.2e-03
lung carcinoma -1.200 5.4e-16
non-small cell lung cancer -2.143 1.7e-20
osteosarcoma -3.434 4.2e-06
psoriasis 1.800 2.2e-31
tuberculosis 2.000 2.3e-05

Gene RIF (12)

AA Sequence

MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSG      1 - 70
SEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPT     71 - 140
LTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRMMKYQQKAAGMSPEQVLQPLEGDLCYADLTL    141 - 210
QLAGTSPQKATTKLSSAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEE    211 - 280
PTEYSTISRP                                                                281 - 290
//

Text Mined References (27)

PMID Year Title